--- doc/loncapafiles/Attic/loncapafiles.html 2000/09/21 17:56:48 1.1 +++ doc/loncapafiles/Attic/loncapafiles.html 2000/10/25 23:55:01 1.16 @@ -1,20 +1,53 @@ - - Untitled Document + + LON-CAPA Files and Directories

LON-CAPA Files and Directories

-
Gerd Kortemeyer, Spring-Summer 2000
Scott Harrison, September 2000 +
Gerd Kortemeyer, Spring-Summer 2000 +

+

    +
  1. Software Package Information +
  2. File and Directory Table +
  3. Software Package Specification File +
  4. Makefile +
+
+

1. Software Package Information

+
Rolled in a RedHat 6.2 RPM, September 27, 2000 +

+ +
+
+Name        : LON-CAPA-base                Relocations: (not relocateable)
+Version     : 3.1                               Vendor: Laboratory for Instructional Technology Education, 
+                                                        Division of Science and Mathematics Education, 
+							Michigan State University.
+Release     : 1                             Build Date: Wed Sep 27 13:56:46 2000
+Install date: (not installed)               Build Host: spock.lite.msu.edu
+Group       : Utilities/System              Source RPM: LON-CAPA-base-3.1-1.src.rpm
+Size        : 3650773                           License: GNU General Public License. Version 2, June 1991.
+                                                        Michigan State University patents may apply.
+Summary     : Basic system files for running a LON-CAPA server.
+Description :
+This package facilitates a base installation of LON-CAPA files in their directories.
+The files in this package are only those directly associated with the network communication
+layer established through direct server-to-server communications (via lond and lonc); plus
+those which configure (but otherwise not constitute) external software packages like Apache
+and Athena-Kerberos.  For more on the LON-CAPA project, visit http://www.lon-capa.org/.
+
+
+

Note: these files only refer to

and, these files @@ -22,9 +55,20 @@ and, these files
  • are all owned by user=www, group=users
  • all represent their install-time configurations (for instance, some directories start out as empty) -
  • are all ONLY under the read-write (and sometimes execute) privileges of user=www (-rwx------) +
  • are all ONLY under the read-write-execute privileges of user=www, +with different sets of permissions based on file type + - +
  • unless otherwise specified, lists are separated by newlines (and subelements are separated with colons ':') + +
    +

    2. File and Directory Table

    @@ -40,30 +84,37 @@ and, these files - - + + - + - - + + - + - - + + - + @@ -74,42 +125,48 @@ and, these files - - + + - - + + - - + - - + + - + offload session to if the LON-CAPA machine is overloaded + @@ -129,7 +186,37 @@ and, these files - + + + + + + + + @@ -140,7 +227,7 @@ and, these files - + @@ -148,21 +235,21 @@ and, these files - + - + - - + + @@ -178,114 +265,170 @@ and, these files + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + - + - + - + - + - + - + - + - + - + - + - + - + - + @@ -297,16 +440,16 @@ and, these files - + - + - + - + @@ -374,14 +517,15 @@ and, these files - + - + @@ -415,7 +559,8 @@ and, these files - - + @@ -549,23 +700,37 @@ sutd.gif + + + + + + + + + + + + + + - + - + - + @@ -577,7 +742,9 @@ sutd.gif - - + - - + + + + + + + + + @@ -639,8 +813,10 @@ mmlextra.ent - - + - + - + - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
    Files & Directoriesconfigurable access.conf confdefine handlers, - set parametersconfigure machine - name, machine function, domain, server admindefine handlers, set parametersconfigure +
    + + + + + + + +
    lonHostIDLON-internal HostID of this machine
    lonRoleRole of this machine: library, access
    lonAdmEMailServer Administration
    lonDefDomainDefault domain
    lonLoadLimLoad Limit ( 100% loadavg )
    lonExpireExpiration for local copies in seconds
    configurableconfigurable httpd.confconf static confmain server configuration file  
    configurableconfigurable srm.confconf static confname space configuration  
    configurable startup.pl static confset paths to modulesset paths to modules; invoked by access.conf  
    static filetypes.tab static confList of all machines - in the network with functionwww-readableDescriptive list of file extensions, and extension groupings 
    static roles.tab static confList of all machines - in the network with functionwww-readableList of privileges associated with users of multiple types (for example: Teaching Assistant, Exam Proctor, Course Coordinator) 
    static rolesplain.tab static confList of all machines + Descriptive list of abbreviations used in roles.tab for user types and privileges available in the network with functionwww-readable 
    static hosts.tab static confList of all machines - in the network with functionwww-readableList of all machines in the LON-CAPA network. Relates lonHostID to lonDefDomain and IP address 
    configurable spare.tab conf Spare hosts to - offload session to if this machine overloadedconfigure, - www-readable +configure
    + + + +
    +list elements are separated by newlines +
    +each list element consists of only one value; the value for lonHostID in access.conf +
    +
    staticconf which Kerberos server to contact for which Kerberos domainsconfigureconfigure
    + + + +
    +list elements are separated by newlines +
    +each list element consists of only two subelements separated by a colon +
    +
      +
    • Kerberos domain value +
    • Kerberos server IP address +
    +
    +
    configurablentp.confconfwhich NTP server to contact for information (XNTP3 standard)configure
    + + + +
    +only one line needs to be changed to specify a server ip address +
    +Example:
    server ntp.msu.edu +
    +
    directory DIRECTORY -- /home/httpd/perllonc script proxy serverwww-executable 
    scriptscript remote command interpreterwww-executable 
    script loncron script housekeepingwww-executable 
    script lonsql scripthousekeepingwww-executablemaintain secondary database of metadata 
    empty directory EMPTY DIRECTORY -- /home/httpd/perl/logs
    handler.giflonmenu.pmhandlerHas routines which control the remote control. 
    handler.giflonpageflip.pmhandlerDeals with forward, backward, and other page flips. 
    handler.giflonratedt.pmhandlerBuilds up frame set and loads in the right thing. 
    handler.gifadmannotations.pmhandlerThis will take annotations and then plug them into a page 
    handler.gifadmbookmarks.pmhandlerThis will take bookmarks and get/write/display them for the LON-CAPA user interface 
    handler.giflonratsrv.pmhandlerHandler tat takes output from RAT and stores it on disk. Handles the upper hidden frame of the added window that comes up in RAT. (3 frames come up in RAT server, code, and output. This module handles server connection.) 
    handler.giflonpage.pmhandlerbundles pages into one page 
    handler.giflonuserstate.pmhandlercompile course into binary data structure (in loncom/rat) 
    handler.giflontex.pmhandlerHandler for tex files (somewhere in loncom/modules) 
    handler.giflontexconvert.pmhandlerAccess to tth/ttm 
    handler.gif lonxml.pm handleraccess to - resXML Parsing Module  
    handler.gif style.pm handleraccess to - resStyle Parsing Module  
    handler.gif londefdef.pm handleraccess to - resTags Default Definition Module  
    handler.gif run.pm handleraccess to - resused to prevent poorly written problems from causing lingering after effects  
    handler.gif scripttag.pm handleraccess to - resimplements <script>, <scriptlib>, <parserlib>, and <import>  
    handler.gif lonhomework.pm handleraccess to - reshandles requests for output, evaluation, and alteration of homework resource  
    handler.gif inputtags.pm handleraccess to - resproduces HTML input tags (<INPUT>) for rendering homework resources  
    handler.gif structuretags.pm handleraccess to - resproduces HTML tags necessary for structuring the presentation of homework resourcese  
    handler.gif response.pm handleraccess to - resdefines different types of responses given to student as well as syntax for producing response values  
    handler.gif caparesponse.pm handleraccess to - reshandles request to the CAPA homework processing engine  
    handler.gif lonacc.pm handleraccess to - resaccess to for a LON-CAPA user session  
    handler.gif lonracc.pm handleraccess to - rawaccess handler for file transfers  
    handler.gif loncacc.pm handleraccess to - construction spaceaccess to construction area  
    handler.gif lonauth.pm handlerauthenticate, - set up session environmentauthenticate, set up session environment  
    handler.giflonrep.pmlonlogout.pm handlerreplicationlogout  
    handler.giflonproblem.pmlonrep.pm handlerassessmentsreplication  
    interface file notfound.html interface filestatic html pagesstatic html page that is shown when an attempt is made to access a document not present on the web server  
    interface file unauthorized.html interface filestatic html pagesstatic html page that is shown when an attempt is made to access a document which is restricted based on +file or server configurations  
    graphic files images for rat + listing
    + 1.1.dt.gif 1.1.empty.gif 1.1.ld.gif @@ -533,7 +678,13 @@ sutd.gif
    *.gif graphic files logosliteani.gif, logo.gif, logos.gif +listing
    + +liteani.gif +logo.gif +logos.gif +
    empty directory EMPTY DIRECTORY -- /home/httpd/lonUsers
    system filetth.pmsystem fileperl module for invoking functions specific to Tex-to-HTML conversion 
    system filetth.sosystem fileshared library file for dynamic loading and unloading 
    system file capa.pm system file perl module for invoking functions specific to CAPA  
    system file capa.bs system file bootstrap file associated with dynamic loading of this module on multiple architectures  
    system file capa.so system file shared library file for dynamic loading and unloading  
    *.ent static conf entity files + +listing
    + isoamsa.ent isoamsb.ent isoamsc.ent @@ -625,10 +792,17 @@ mmlextra.ent
     
    graphic fileinterface file londes.jsscript interface fileEncryption Routines according to Data Encryption Standard DES, written in javascript 
    handlerdefault_homework.lcpmhandlerused by lonxml::xmlparse() as input variable $safeinit to Apache::run::run()  
    graphic file *.gif graphic fileslogos + icons used for the entire LON-CAPA user interface +listing
    + a.gif b.gif c.gif @@ -693,23 +869,388 @@ z.gif
    interface file imgmaps.html interface file image maps for the LON-CAPA remote control  
    interface file index.html interface file welcoming page to the LON-CAPA system upon login  
    interface file menu.html interface file renders the HTML (including image maps) for the LON-CAPA remote control 
    directory DIRECTORY -- /home/httpd/html/res/adm/pages/bookmarkmenu 
    graphic file*.gifgraphic filesicons used for the bookmark portion of the LON-CAPA user interface +listing
    + +button_close.gif +button_edit.gif +button_preview.gif +folder_closed.gif +folder_closed_pressed.gif +folder_new.gif +folder_opened.gif +folder_opened_pressed.gif +folder_pointer_closed.gif +folder_pointer_opened.gif +folder_spacer.gif +folder_trash.gif +left_bar.gif +line_l_shape.gif +line_side_T.gif +line_vertical.gif +link.gif +link_pressed.gif +ll_corner.gif +lower_bar.gif +lr_corner.gif +right_bar.gif +toolbar_bg.gif +ul_corner.gif +upper_bar.gif +ur_corner.gif +
    interface file*.htmlinterface fileassociated with the frameset scheme of displaying bookmarks +aaloader.html +annotator_bb.html +annotator_left.html +annotator_ll.html +annotator_lr.html +annotator_right.html +annotator_toolbar.html +annotator_ul.html +annotator_ur.html +annotator_uu.html +bookmarkpal.html +bookmarkpal_old.html +bookmarkpal_v2.html +bookmarkpal_v2_backup.html +index.html +loading_bookmarks.html +
    interface filebookmarklib.jsinterface filejavascript for handling client-side interactions with bookmark interface 
    directory DIRECTORY -- /home/httpd/html/res/adm/pages/annotations 
    directory DIRECTORY -- /usr/sbin 
    script fileloncapaverifypackagesscriptchecks the system RPMs against what install.lon-capa.org specifies 
    script fileloncapaverifybasepackagescriptchecks the important base LON-CAPA files against what install.lon-capa.org specifies 
    script fileloncapaverifybasepackagescriptchecks the system RPMs against what install.lon-capa.org specifies 
    interface fileimgmaps.htmlinterface fileimage maps for the LON-CAPA remote control 
    interface fileindex.htmlinterface filewelcoming page to the LON-CAPA system upon login 
    interface filemenu.htmlinterface filerenders the HTML (including image maps) for the LON-CAPA remote control  
    +
    +

    3. Software Package Specification File

    +
    +Summary: Basic files for running a LON-CAPA server.
    +Name: LON-CAPA-base
    +Version: 3.1
    +Release: 1
    +Vendor: Laboratory for Instructional Technology Education, Division of Science and Mathematics Education, Michigan State University.
    +BuildRoot: /home/harris41/LON-CAPA-BuildRoot
    +Copyright: GNU General Public License. Version 2, June 1991.  Michigan State University patents may apply.
    +Group: Utilities/System
    +Source: LON-CAPA-base-3.1.tar.gz
    +AutoReqProv: no
    +# requires: filesystem
    +%description
    +This package facilitates a base installation of LON-CAPA files in their directories.
    +The files in this package are only those directly associated with the network communication
    +layer established through direct server-to-server communications (via lond and lonc); plus
    +those which configure (but otherwise not constitute) external software packages like Apache
    +and Athena-Kerberos.  For more on the LON-CAPA project, visit http://www.lon-capa.org/.
    +
    +%prep
    +%setup
    +
    +%build
    +rm -Rf "/home/harris41/LON-CAPA-BuildRoot"
    +
    +%install
    +# ROOT="$RPM_BUILD_ROOT"
    +# SOURCE="/home/harris41/LON-CAPA-topdir_for_build/SOURCES/LON-CAPA-base-3.1/LON-CAPA/SourceRoot"
    +make ROOT="$RPM_BUILD_ROOT" SOURCE="/home/harris41/LON-CAPA-topdir_for_build/SOURCES/LON-CAPA-base-3.1/SourceRoot" directories
    +make ROOT="$RPM_BUILD_ROOT" SOURCE="/home/harris41/LON-CAPA-topdir_for_build/SOURCES/LON-CAPA-base-3.1/SourceRoot" files
    +
    +%pre
    +echo "***********************************************************************"
    +echo "LON-CAPA  LearningOnline with CAPA"
    +echo "http://www.lon-capa.org/"
    +echo "Gerd Kortemeyer, et al"
    +echo "Laboratory for Instructional Technology Education"
    +echo "Michigan State University"
    +echo "General Public License, Version 2, June 1991"
    +echo "** Michigan State University patents may apply **"
    +echo " "
    +echo "This installation assumes an installation of Redhat 6.2"
    +echo " "
    +echo "The server computer should be currently connected to the ethernet"
    +echo " "
    +echo "The files in this package are only those directly associated with the network communication"
    +echo "layer established through direct server-to-server communications (via lond and lonc); plus"
    +echo "those which configure (but otherwise not constitute) external software packages like Apache"
    +echo "and Athena-Kerberos."
    +echo "***********************************************************************"
    +
    +%post
    +%postun
    +
    +%files
    +%doc README COPYING ChangeLog LICENSE
    +%dir %attr(700,www,users) /etc/httpd/conf
    +%config %attr(600,www,users) /etc/httpd/conf/access.conf
    +%attr(400,www,users) /etc/httpd/conf/httpd.conf
    +%attr(400,www,users) /etc/httpd/conf/srm.conf
    +%attr(400,www,users) /etc/httpd/conf/startup.pl
    +%dir %attr(700,www,users) /home/httpd/lonTabs
    +%attr(400,www,users) /home/httpd/lonTabs/filetypes.tab
    +%attr(400,www,users) /home/httpd/lonTabs/roles.tab
    +%attr(400,www,users) /home/httpd/lonTabs/rolesplain.tab
    +%attr(400,www,users) /home/httpd/lonTabs/hosts.tab
    +%config %attr(600,www,users) /home/httpd/lonTabs/spare.tab
    +%attr(400,www,users) /home/httpd/lonTabs/htpasswd
    +%config %attr(600,www,users) /etc/krb.conf
    +%attr(500,www,users) /home/httpd/perl/lonc
    +%attr(500,www,users) /home/httpd/perl/lond
    +%attr(500,www,users) /home/httpd/perl/loncron
    +%attr(500,www,users) /home/httpd/perl/lonsql
    +%dir %attr(700,www,users) /home/httpd/perl/logs
    +%dir %attr(700,www,users) /home/httpd/perl/tmp
    +%dir %attr(500,www,users) /home/httpd/lib/perl/Apache
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonratedt.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonratsrv.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonpage.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonuserstate.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lontex.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lontexconvert.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonxml.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/style.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/londefdef.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/run.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/scripttag.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonhomework.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/inputtags.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/structuretags.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/response.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/caparesponse.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonacc.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonracc.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/loncacc.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonauth.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonlogin.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonlogout.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonrep.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonroles.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonindexer.pm
    +%attr(400,www,users) /home/httpd/lib/perl/Apache/lonnet.pm
    +%dir %attr(700,www,users) /home/httpd/lonIDs
    +%dir %attr(700,www,users) /home/httpd/sockets
    +%dir %attr(700,www,users) /home/httpd/sockets/delayed
    +%dir %attr(700,www,users) /home/httpd/html
    +%attr(400,www,users) /home/httpd/html/index.html
    +%dir %attr(700,www,users) /home/httpd/html/res
    +%attr(-,www,users) /home/httpd/html/raw
    +%dir %attr(500,www,users) /home/httpd/html/adm
    +%attr(400,www,users) /home/httpd/html/adm/notfound.html
    +%attr(400,www,users) /home/httpd/html/adm/unauthorized.html
    +%dir %attr(500,www,users) /home/httpd/html/adm/rat
    +%attr(400,www,users) /home/httpd/html/adm/rat/rat.html
    +%attr(400,www,users) /home/httpd/html/adm/rat/code.html
    +%attr(400,www,users) /home/httpd/html/adm/rat/map.html
    +%attr(400,www,users) /home/httpd/html/adm/rat/*.gif
    +%dir %attr (500,www,users) /home/httpd/html/adm/lonIcons
    +%attr (400,www,users) /home/httpd/html/adm/lonIcons/*.gif
    +%dir %attr (700,www,users) /home/httpd/lonUsers
    +%dir %attr (700,www,users) /home/httpd/lon-status
    +%attr (400,www,users) /usr/lib/perl5/site_perl/5.005/tth.bs
    +%attr (400,www,users) /usr/lib/perl5/site_perl/5.005/tth.pm
    +%attr (500,www,users) /usr/lib/perl5/site_perl/5.005/tth.so
    +%attr (400,www,users) /usr/lib/perl5/site_perl/5.005/capa.pm
    +%attr (400,www,users) /usr/lib/perl5/site_perl/5.005/capa.bs
    +%attr (500,www,users) /usr/lib/perl5/site_perl/5.005/capa.so
    +%dir %attr (500,www,users) /home/httpd/html/adm/MathML
    +%attr (400,www,users) /home/httpd/html/adm/MathML/*.ent
    +%attr (400,www,users) /home/httpd/html/adm/MathML/mathml.css
    +%attr (400,www,users) /home/httpd/html/adm/MathML/mathml.dtd
    +%dir %attr (500,www,users) /home/httpd/html/res/adm/includes
    +%attr (400,www,users) /home/httpd/html/res/adm/includes/londes.js
    +%attr (400,www,users) /home/httpd/html/res/adm/includes/default_homework.lcpm
    +%dir %attr (500,www,users) /home/httpd/html/res/adm/pages
    +%dir %attr (500,www,users) /home/httpd/html/res/adm/pages/bookmarkmenu
    +%dir %attr (500,www,users) /home/httpd/html/res/adm/pages/annotations
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/*.gif
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/imgmaps.html
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/index.html
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/menu.html
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/bookmarkmenu/*.gif
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/bookmarkmenu/bookmarklib.js
    +%attr (400,www,users) /home/httpd/html/res/adm/pages/bookmarkmenu/*.html
    +
    +
    +

    4. Makefile

    +
    +directories:
    +	install -m 0700 -d $(SOURCE)/etc/httpd/conf $(ROOT)/etc/httpd/conf
    +	install -m 0700 -d $(SOURCE)/home/httpd/lonTabs $(ROOT)/home/httpd/lonTabs
    +	install -m 0700 -d $(SOURCE)/home/httpd/perl $(ROOT)/home/httpd/perl
    +	install -m 0700 -d $(SOURCE)/home/httpd/perl/logs $(ROOT)/home/httpd/perl/logs
    +	install -m 0700 -d $(SOURCE)/home/httpd/perl/tmp $(ROOT)/home/httpd/perl/tmp
    +	install -m 0500 -d $(SOURCE)/home/httpd/lib/perl/Apache $(ROOT)/home/httpd/lib/perl/Apache
    +	install -m 0700 -d $(SOURCE)/home/httpd/lonIDs $(ROOT)/home/httpd/lonIDs
    +	install -m 0700 -d $(SOURCE)/home/httpd/sockets $(ROOT)/home/httpd/sockets
    +	install -m 0700 -d $(SOURCE)/home/httpd/sockets/delayed $(ROOT)/home/httpd/sockets/delayed
    +	install -m 0700 -d $(SOURCE)/home/httpd/html $(ROOT)/home/httpd/html
    +	install -m 0700 -d $(SOURCE)/home/httpd/html/res $(ROOT)/home/httpd/html/res
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/adm $(ROOT)/home/httpd/html/adm
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/adm/rat $(ROOT)/home/httpd/html/adm/rat
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/adm/lonIcons $(ROOT)/home/httpd/html/adm/lonIcons
    +	install -m 0700 -d $(SOURCE)/home/httpd/lonUsers $(ROOT)/home/httpd/lonUsers
    +	install -m 0700 -d $(SOURCE)/home/httpd/lon-status $(ROOT)/home/httpd/lon-status
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/adm/MathML $(ROOT)/home/httpd/html/adm/MathML
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/res/adm/includes $(ROOT)/home/httpd/html/res/adm/includes
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/res/adm/pages $(ROOT)/home/httpd/html/res/adm/pages
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/res/adm/pages $(ROOT)/home/httpd/html/res/adm/pages/bookmarkmenu
    +	install -m 0500 -d $(SOURCE)/home/httpd/html/res/adm/pages $(ROOT)/home/httpd/html/res/adm/pages/annotations
    +	install -m 0500 -d $(SOURCE)/usr/lib/perl5/site_perl/5.005 $(ROOT)/usr/lib/perl5/site_perl/5.005
    +
    +files:
    +	install -m 0600 $(SOURCE)/etc/httpd/conf/access.conf $(ROOT)/etc/httpd/conf/access.conf
    +	install -m 0400 $(SOURCE)/etc/httpd/conf/httpd.conf $(ROOT)/etc/httpd/conf/httpd.conf
    +	install -m 0400 $(SOURCE)/etc/httpd/conf/srm.conf $(ROOT)/etc/httpd/conf/srm.conf
    +	install -m 0400 $(SOURCE)/etc/httpd/conf/startup.pl $(ROOT)/etc/httpd/conf/startup.pl
    +	install -m 0400 $(SOURCE)/home/httpd/lonTabs/filetypes.tab $(ROOT)/home/httpd/lonTabs/filetypes.tab
    +	install -m 0400 $(SOURCE)/home/httpd/lonTabs/roles.tab $(ROOT)/home/httpd/lonTabs/roles.tab
    +	install -m 0400 $(SOURCE)/home/httpd/lonTabs/rolesplain.tab $(ROOT)/home/httpd/lonTabs/rolesplain.tab
    +	install -m 0400 $(SOURCE)/home/httpd/lonTabs/hosts.tab $(ROOT)/home/httpd/lonTabs/hosts.tab
    +	install -m 0600 $(SOURCE)/home/httpd/lonTabs/spare.tab $(ROOT)/home/httpd/lonTabs/spare.tab
    +	install -m 0400 $(SOURCE)/home/httpd/lonTabs/htpasswd $(ROOT)/home/httpd/lonTabs/htpasswd
    +	install -m 0600 $(SOURCE)/etc/krb.conf $(ROOT)/etc/krb.conf
    +	install -m 0500 $(SOURCE)/home/httpd/perl/lonc $(ROOT)/home/httpd/perl/lonc
    +	install -m 0500 $(SOURCE)/home/httpd/perl/lond $(ROOT)/home/httpd/perl/lond
    +	install -m 0500 $(SOURCE)/home/httpd/perl/loncron $(ROOT)/home/httpd/perl/loncron
    +	install -m 0500 $(SOURCE)/home/httpd/perl/lonsql $(ROOT)/home/httpd/perl/lonsql
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonratedt.pm $(ROOT)/home/httpd/lib/perl/Apache/lonratedt.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonratsrv.pm $(ROOT)/home/httpd/lib/perl/Apache/lonratsrv.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonpage.pm $(ROOT)/home/httpd/lib/perl/Apache/lonpage.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonuserstate.pm $(ROOT)/home/httpd/lib/perl/Apache/lonuserstate.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lontex.pm $(ROOT)/home/httpd/lib/perl/Apache/lontex.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lontexconvert.pm $(ROOT)/home/httpd/lib/perl/Apache/lontexconvert.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonxml.pm $(ROOT)/home/httpd/lib/perl/Apache/lonxml.pm 
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/style.pm $(ROOT)/home/httpd/lib/perl/Apache/style.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/londefdef.pm $(ROOT)/home/httpd/lib/perl/Apache/londefdef.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/run.pm $(ROOT)/home/httpd/lib/perl/Apache/run.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/scripttag.pm $(ROOT)/home/httpd/lib/perl/Apache/scripttag.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonhomework.pm $(ROOT)/home/httpd/lib/perl/Apache/lonhomework.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/inputtags.pm $(ROOT)/home/httpd/lib/perl/Apache/inputtags.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/structuretags.pm $(ROOT)/home/httpd/lib/perl/Apache/structuretags.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/response.pm $(ROOT)/home/httpd/lib/perl/Apache/response.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/caparesponse.pm $(ROOT)/home/httpd/lib/perl/Apache/caparesponse.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonacc.pm $(ROOT)/home/httpd/lib/perl/Apache/lonacc.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonracc.pm $(ROOT)/home/httpd/lib/perl/Apache/lonracc.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/loncacc.pm $(ROOT)/home/httpd/lib/perl/Apache/loncacc.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonauth.pm $(ROOT)/home/httpd/lib/perl/Apache/lonauth.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonlogin.pm $(ROOT)/home/httpd/lib/perl/Apache/lonlogin.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonlogout.pm $(ROOT)/home/httpd/lib/perl/Apache/lonlogout.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonrep.pm $(ROOT)/home/httpd/lib/perl/Apache/lonrep.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonroles.pm $(ROOT)/home/httpd/lib/perl/Apache/lonroles.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonindexer.pm $(ROOT)/home/httpd/lib/perl/Apache/lonindexer.pm
    +	install -m 0400 $(SOURCE)/home/httpd/lib/perl/Apache/lonnet.pm $(ROOT)/home/httpd/lib/perl/Apache/lonnet.pm
    +	install -m 0400 $(SOURCE)/home/httpd/html/index.html $(ROOT)/home/httpd/html/index.html
    +	ln -s /home/httpd/html/res $(ROOT)/home/httpd/html/raw
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/notfound.html $(ROOT)/home/httpd/html/adm/notfound.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/unauthorized.html $(ROOT)/home/httpd/html/adm/unauthorized.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/rat/rat.html $(ROOT)/home/httpd/html/adm/rat/rat.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/rat/code.html $(ROOT)/home/httpd/html/adm/rat/code.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/rat/map.html $(ROOT)/home/httpd/html/adm/rat/map.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/rat/*.gif $(ROOT)/home/httpd/html/adm/rat/.
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/lonIcons/*.gif $(ROOT)/home/httpd/html/adm/lonIcons/.
    +	install -m 0400 $(SOURCE)/usr/lib/perl5/site_perl/5.005/tth.pm $(ROOT)/usr/lib/perl5/site_perl/5.005/tth.pm
    +	install -m 0400 $(SOURCE)/usr/lib/perl5/site_perl/5.005/tth.bs $(ROOT)/usr/lib/perl5/site_perl/5.005/tth.bs
    +	install -m 0500 $(SOURCE)/usr/lib/perl5/site_perl/5.005/tth.so $(ROOT)/usr/lib/perl5/site_perl/5.005/tth.so
    +	install -m 0400 $(SOURCE)/usr/lib/perl5/site_perl/5.005/capa.pm $(ROOT)/usr/lib/perl5/site_perl/5.005/capa.pm
    +	install -m 0400 $(SOURCE)/usr/lib/perl5/site_perl/5.005/capa.bs $(ROOT)/usr/lib/perl5/site_perl/5.005/capa.bs
    +	install -m 0500 $(SOURCE)/usr/lib/perl5/site_perl/5.005/capa.so $(ROOT)/usr/lib/perl5/site_perl/5.005/capa.so
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/MathML/*.ent $(ROOT)/home/httpd/html/adm/MathML/.
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/MathML/mathml.css $(ROOT)/home/httpd/html/adm/MathML/mathml.css
    +	install -m 0400 $(SOURCE)/home/httpd/html/adm/MathML/mathml.dtd $(ROOT)/home/httpd/html/adm/MathML/mathml.dtd
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/includes/londes.js $(ROOT)/home/httpd/html/res/adm/includes/londes.js
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/*.gif $(ROOT)/home/httpd/html/res/adm/pages/.
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/imgmaps.html $(ROOT)/home/httpd/html/res/adm/pages/imgmaps.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/index.html $(ROOT)/home/httpd/html/res/adm/pages/index.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/menu.html $(ROOT)/home/httpd/html/res/adm/pages/menu.html
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/bookmarkmenu/*.gif $(ROOT)/home/httpd/html/res/adm/pages/bookmarkmenu/.
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/bookmarkmenu/*.html $(ROOT)/home/httpd/html/res/adm/pages/bookmarkmenu/.
    +	install -m 0400 $(SOURCE)/home/httpd/html/res/adm/pages/bookmarkmenu/bookmarklib.js $(ROOT)/home/httpd/html/res/adm/pages/bookmarkmenu/bookmarklib.js
    +
    +