--- doc/loncapafiles/Attic/loncapafiles.html 2000/11/10 17:45:47 1.25 +++ doc/loncapafiles/Attic/loncapafiles.html 2001/08/08 03:06:49 1.117 @@ -27,7 +27,7 @@ The format of these tags is:

Here are examples of all the different types of LONCAPA make/build tags. -
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/modules/TexConvert/tthperl/lontex.pm" TARGET="home/httpd/lib/perl/Apache/lontex.pm" CATEGORY="handler"> +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="modules/TexConvert/tthperl/lontex.pm" TARGET="home/httpd/lib/perl/Apache/lontex.pm" CATEGORY="handler">
<LONCAPA TYPE=DIRECTORY DIST="redhat6.2" TARGET="home/httpd/lib/perl/Apache" CATEGORY="writeable by server">
<LONCAPA TYPE=OWNERSHIP DIST="redhat6.2" CATEGORY="setuid" CHMOD="6755" CHOWN="root:root">
<LONCAPA TYPE=RPM NAME="Vendor" VALUE="Laboratory for Instructional Technology Education, Division of Science and Mathematics Education, Michigan State University."> @@ -52,19 +52,19 @@ The NAME tags associated with TYPE=RPM a

Data can also be attached to any LON-CAPA tag. This is especially important for files. This is shown by these three examples:
<METAGROUP> -
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/modules/TexConvert/tthperl/lontex.pm" TARGET="home/httpd/lib/perl/Apache/lontex.pm" CATEGORY="handler"> +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="modules/TexConvert/tthperl/lontex.pm" TARGET="home/httpd/lib/perl/Apache/lontex.pm" CATEGORY="handler">
<DESCRIPTION>
Handler for TeX files
</DESCRIPTION>
</METAGROUP>
 
<METAGROUP> -
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/modules/TexConvert/tthperl/tth.so" TARGET="usr/lib/perl5/site_perl/5.005/tth.so" CATEGORY="system file"> +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="modules/TexConvert/tthperl/tth.so" TARGET="usr/lib/perl5/site_perl/5.005/tth.so" CATEGORY="system file">
<DESCRIPTION>
shared library file for dynamic loading and unloading of TeX-to-HTML functionality
</DESCRIPTION>
<BUILD> -
loncom/modules/TexConvert/tthperl/commands +
modules/TexConvert/tthperl/commands
</BUILD>
<DEPENDENCIES>
../tthdynamic/tthfunc.c @@ -104,6 +104,8 @@ you can just view the internal tags of t This section contains the actual LONCAPA tag information. These tags are probably not viewable with your browser and can only be seen be examining the HTML source.

+ + @@ -140,29 +142,33 @@ browser and can only be seen be examinin - + + - + - - - + + + - - - + + + - - + + + + + @@ -170,7 +176,15 @@ browser and can only be seen be examinin + + + + + + + + @@ -180,7 +194,16 @@ browser and can only be seen be examinin -define handlers, set parameters +This file has two major functions. +For the Apache web server, it defines a global +access configuration which defines what server options (Indexes", "Includes", +"FollowSymLinks", "ExecCGI", or "MultiViews") are associated +with specific directories ("/", "/home/httpd/html", "/home/httpd/cgi-bin", +and "/usr/doc"). For the LON-CAPA network server and perl module +handlers, it defines machine specific settings (lonHostID, lonRole, +lonAdmEMail, lonDefDomain, lonLoadLim, lonExpire, and lonReceipt) +and internal machine settings for specific directories, socket ports, +and browser detection logic. configure @@ -196,60 +219,156 @@ define handlers, set parameters - + -main server configuration file +This is the main server configuration file. The settings here are +more or less standard for the Apache web server. Most notably (and +importantly!), perl handling and mod_perl are enabled in this configuration +file. - + -name space configuration +

+This file configures the "name space" of the Apache web server. +srm.conf +defines when specific perl modules should be called to handle a given +request. This definition is a function of both the name of the perl module, +and a specific regular expression associated with the URL, such as +"^/res/.*\.page". +

+

+Here is an example entry: +

+<LocationMatch "^/res/.*\.page$>
+SetHandler perl-script
+PerlHandler Apache::lonpage
+</LocationMatch>
+
+

-set paths to modules; invoked by access.conf +This file provides initializations for perl handlers. It adjusts what +the module path space is (so as to include /home/httpd/lib/perl/Apache) as +well as causing the Apache module to be used for every perl handler. +startup.pl is invoked by access.conf. - + -Descriptive list of file extensions, and extension groupings +Config file for "My Desk" - - - directory DIRECTORY -- /home/httpd/lonTabs - static - roles.tab - static conf - List of privileges associated with users of multiple types (for example: Teaching Assistant, Exam Proctor, Course Coordinator) -   - - - static - rolesplain.tab - static conf - Descriptive list of abbreviations used in roles.tab for user types and privileges available - in the network with function -   - - - configurable - hosts.tab - conf - List of all machines in the LON-CAPA network. Relates lonHostID to lonDefDomain and IP address -   - - - configurable - spare.tab - conf - Spare hosts to - offload session to if the LON-CAPA machine is overloaded - + + + +Descriptive list of file extensions, and extension groupings. + + + + + +Describes what tags are allowed inside other tags. + + + + + +Template file. + + + + + +Template file. + + + + + +Template file. + + + + + +Template file. + + + + + +Template file. + + + + + +Template file. + + + + + +Template file. + + + + + +Template file. + + + + + +Default spreadsheet for individual assessment. + + + + + +Default spreadsheet for assessment of students. + + + + + +Default spreadsheet for assessment of a class. + + + + + +List of privileges associated with users of multiple types (for example: Teaching +Assistant, Exam Proctor, Course Coordinator) + + + + + +Descriptive list of abbreviations used in roles.tab for user types +and privileges available in the network with function + + + + + +List of all machines in the LON-CAPA network. Relates lonHostID to +lonDefDomain and IP address + + + + + +Spare hosts to offload session to if the LON-CAPA machine is overloaded + + configure
@@ -259,26 +378,20 @@ list elements are separated by newlines each list element consists of only one value; the value for lonHostID in access.conf
- - - - static - htpasswd - static conf - Basic auth - password to access /lon-status and /server-status -   - - - directory DIRECTORY -- /etc -   - - - configurable - krb.conf - conf - which Kerberos server to contact for which Kerberos domains - configure
+
+
+ + + +Basic auth password to access /lon-status and /server-status + + + + + +which Kerberos server to contact for which Kerberos domains + +
list elements are separated by newlines @@ -292,21 +405,23 @@ each list element consists of only two s
- - - - configurable - smb.conf - conf - configuration file to make LON-CAPA server file space accessible to network neighborhood - configure
- - - configurable - ntp.conf - conf - which NTP server to contact for information (XNTP3 standard) - configure
+
+
+ + + +configuration file to make LON-CAPA server file space accessible to network neighborhood + + +configure + + + + + +which NTP server to contact for information (XNTP3 standard) + +
only one line needs to be changed to specify a server ip address @@ -315,386 +430,678 @@ only one line needs to be changed to spe Example:
server ntp.msu.edu
- - - - directory DIRECTORY -- /home/httpd/perl - Communication - - - script - lonc - script - proxy server -   - - - script - lond - script - remote command - interpreter -   - - - script - loncron - script - housekeeping -   - - - script - lonsql - script - maintain secondary database of metadata -   - - - setuid - lcpasswd - setuid script - coordinates the system services and files in order to allow lond to change user passwords -   - - - setuid - lcuseradd - setuid script - coordinates the system services and files in order to allow lond to add a new user -   - - - setuid - lcpasswd - setuid script - coordinates the system services and files in order to allow lond to add a new user -   - - - setuid - lcnfson - setuid script - coordinates the system services and files in order to allow lond to enable NFS for a user -   - - - setuid - lcnfsoff - setuid script - coordinates the system services and files in order to allow lond to enable NFS for a user -   - - - empty directory EMPTY DIRECTORY -- /home/httpd/perl/logs - logs and pids of lonc, lond and lonnet.pm - - - empty directory EMPTY DIRECTORY -- /home/httpd/perl/tmp - logs and pids of lonc, lond and lonnet.pm - - - directory DIRECTORY -- /home/httpd/lib/perl/Apache - handlers - - - handler.gif - lonmenu.pm - handler - Has routines which control the remote control. -   - - - handler.gif - lonpageflip.pm - handler - Deals with forward, backward, and other page flips. -   - - - handler.gif - lonratedt.pm - handler - Builds up frame set and loads in the right thing. -   - - - handler.gif - admannotations.pm - handler - This will take annotations and then plug them into a page -   - - - handler.gif - admbookmarks.pm - handler - This will take bookmarks and get/write/display them for the LON-CAPA user interface -   - - - handler.gif - lonratsrv.pm - handler - Handler tat takes output from RAT and stores it on disk. Handles the upper hidden frame of the added window that comes up in RAT. (3 frames come up in RAT server, code, and output. This module handles server connection.) -   - - - handler.gif - lonpage.pm - handler - bundles pages into one page -   - - - handler.gif - lonuserstate.pm - handler - compile course into binary data structure (in loncom/rat) -   - - - handler.gif - lontex.pm - handler - Handler for tex files (somewhere in loncom/modules) -   - - - handler.gif - lontexconvert.pm - handler - Access to tth/ttm -   - - - handler.gif - lonxml.pm - handler - XML Parsing Module -   - - - handler.gif - style.pm - handler - Style Parsing Module -   - - - handler.gif - londefdef.pm - handler - Tags Default Definition Module -   - - - handler.gif - run.pm - handler - used to prevent poorly written problems from causing lingering after effects -   - - - handler.gif - scripttag.pm - handler - implements <script>, <scriptlib>, <parserlib>, and <import> -   - - - handler.gif - lonhomework.pm - handler - handles requests for output, evaluation, and alteration of homework resource -   - - - handler.gif - inputtags.pm - handler - produces HTML input tags (<INPUT>) for rendering homework resources -   - - - handler.gif - structuretags.pm - handler - produces HTML tags necessary for structuring the presentation of homework resourcese -   - - - handler.gif - response.pm - handler - defines different types of responses given to student as well as syntax for producing response values -   - - - handler.gif - caparesponse.pm - handler - handles request to the CAPA homework processing engine -   - - - handler.gif - lonacc.pm - handler - access to for a LON-CAPA user session -   - - - handler.gif - lonracc.pm - handler - access handler for file transfers -   - - - handler.gif - loncacc.pm - handler - access to construction area -   - - - handler.gif - lonauth.pm - handler - authenticate, set up session environment -   - - - handler.gif - lonlogin.pm - handler - login screen -   - - - handler.gif - lonlogout.pm - handler - logout -   - - - handler.gif - lonrep.pm - handler - replication -   - - - handler.gif - lonroles.pm - handler - roles picking -   - - - handler.gif - lonindexer.pm - handler - cross server - filesystem browser -   - - - handler.gif - lonnet.pm - handler - interface - to lonc -   - - - empty directory EMPTY DIRECTORY -- /home/httpd/lonIDs - cookie jar - - - empty directoryEMPTY DIRECTORY -- /home/httpd/sockets - lonc's sockets - - - empty directoryEMPTY DIRECTORY -- /home/httpd/sockets/delayed - lonc's sockets - - - directory DIRECTORY -- /home/httpd/html -    - - - interface file - index.html - interface file - bumps to login -   - - - link - raw - symbolic link - symbolic link to /home/httpd/html/res -   - - - emptydirectory EMPTY DIRECTORY -- /home/httpd/html/res - root of resource tree - - - directory DIRECTORY -- /home/httpd/html/adm - unauthenticated resources - - - interface file - notfound.html - interface file - static html page that is shown when an attempt is made to access a document not present on the web server -   - - - interface file - unauthorized.html - interface file - static html page that is shown when an attempt is made to access a document which is restricted based on -file or server configurations -   - - - directory DIRECTORY -- /home/httpd/html/adm/rat - home of the rat - - - interface file - rat.html - interface file - frameset -   - - - interface file - code.html - interface file - javascript -   - - - interface file - map.html - interface file - bumper -   - - - graphic file - *.gif - graphic files - images for - rat - listing
- +
+
+ + + +Batch script for updating SQL metadata database. + + + + + +proxy server + + + + + +This is a remote command interpreter on a TCP LON-CAPA network layer. +It accepts and processes incoming requests from other LON-CAPA machines +on the network. lond's functionality is self-contained in the sense +that it does not reference (import, require, use) any other file +described in this document. There are only 15 subroutines in this +script, however the make_new_child subroutine is quite +complex since it parses and responds about 29 different types of +network requests (i.e. enc, ping, pong, ekey, load, auth, passwd, +makeuser, home, update, unsub, sub, log, put, rolesput, get, eget, +del, keys, dump, store, restore, querysend, queryreply, idput, idget, +tmpput, tmpget, and ls). + + + + + +housekeeping + + + + + +maintain secondary database of metadata + + + + + +coordinates the system services and files in order to allow lond to change user passwords + + + + + +coordinates the system services and files in order to allow lond to add a new user + + + + + +coordinates the system services and files in order to allow lond to delete a user + + + + + +coordinates the system services and files in order to allow lond to enable NFS for a user + + + + + +coordinates the system services and files in order to allow lond to disable NFS for a user + + + + + +HTML frame that presents a form element to allow for the publishing of +resources, directories and underlying subdirectories. + + + + + +Interface file for responding to improper page flipping. + + + + + +The relevant conditions and metadata to attach to LectureOnline-specific tags. + + + + + +File which contains words which should not be keywords used to specify resource +content. + + + + + +Parameter packages, so that assessments can publish parameter packages +needed, which are then expanded into individual parameters - allows to +retroactively add new parameters to already published assessments. + + + + + +Table which contains list of copyright possibilities for educational resources. + + + + + +Table which contains string abbreviations of language::font rendering +combinations. + + + + + +Table which has hash data necessary for distinguishing IDs from indices. + + + + + +Wrapper for external and binary files as standalone resources. +Edit handler for rat maps; TeX content handler. + +works/unverified + + + + +Provides web-based functionality for file copy, rename, mkdir, etc, in the +construction space menu. + +works/unverified + + + + +Handler to show statistics on solving LON-CAPA problems. + +works/unverified + + + + +Handler to show difference between two files. + +works/unverified + + + + +Handler to upload files through browser into construction space. + +works/unverified + + + + +Handler to evaluate essay (ungraded) style responses. + +works/unverified + + + + +Handler to publish directories. + +works/unverified + + + + +Handler to retrieve old versions from resource space. + +works/unverified + + + + +Helper functions when in homework edit mode. + +works/unverified + + + + +Metadata display handler. + +works/unverified + + + + +Handler to resolve ambiguous file locations. + +works/unverified + + + + +Handler to set resource parameters inside of the RAT based on metadata. + +works/unverified + + + + +Handler for showing sequence objects of educational resources. + +works/unverified + + + + +Creates a new course and assigns course coordinator. + +works/unverified + + + + +Creates a new user and/or changes user privileges + +works/unverified + + + + +Produces simple LectureOnline-like student assessment performance chart + +works/unverified + + + + +Makes a table out of the previous attempts. Inputs result_from_symbread, +user, domain, home_server, course_id + +works/unverified + + + + +Handles the viewing of grades. + + + + + +Coordinates the response to clicking an image. + + + + + +Handles tags associated with showing a list of options. + + + + + +Handles tags associated with output. Seems to relate to due dates of the +assignment. + + + + + +Used for debugging and testing the LON-CAPA system. + + + + + +Handles multiple-choice style responses. + + + + + +Handles processing of assignments. + + + + + +Handles communication. + + + + + +Handles errors. + + + + + +Handles evaluation. + + + + + +Handles feedback from students to instructors and system administrators. + + + + + +Handles navigational maps. + + + + + +Handles user preferences associated with customizing the online LON-CAPA +educational environment. + + + + + +Handles the production of printable files and resources. + + + + + +Handles a searchable catalogue. + + + + + +Handler to drop and add students in courses. + + + + + +Routines for messaging. + + + + + +This handler coordinates the delivery of hints to students working on LON-CAPA +problems and assignments. + + + + + +Spreadsheet/Grades Display Handler + + + + + +Handler to resolve ambiguous file locations + + + + + +Page wrapper for handling construction space. + + + + + +Publishes an LON-CAPA educational resource complete with metadata +(authorship, language, copyright, creation date, etc). + + + + + +Has routines which control the remote control. + + + + + +Deals with forward, backward, and other page flips. + + + + + +Builds up frame set and loads in the right thing. + + + + + +Homework remote control. + + + + + +This will take annotations and then plug them into a page + + + + + +This will take bookmarks and get/write/display them for the LON-CAPA user interface + + + + + +Handler tat takes output from RAT and stores it on disk. Handles the upper hidden +frame of the added window that comes up in RAT. (3 frames come up in RAT server, +code, and output. This module handles server connection.) + + + + + +bundles pages into one page + + + + + +compile course into binary data structure (in loncom/rat) + + + + + +Handler for tex files (somewhere in modules) + + + + + +Access to tth/ttm + + + + + +XML Parsing Module + + + + + +Style Parsing Module + + + + + +Tags Default Definition Module + + + + + +used to prevent poorly written problems from causing lingering after effects + + + + + +implements <script>, <scriptlib>, <parserlib>, and <import> + + + + + +handles requests for output, evaluation, and alteration of homework resource + + + + + +produces HTML input tags (<INPUT>) for rendering homework resources + + + + + +produces HTML tags necessary for structuring the presentation of homework resources + + + + + +defines different types of responses given to student as well as syntax for producing response values + + + + + +handles request to the CAPA homework processing engine + + + + + +(This module, like loncacc.pm also authenticates with cookies.) +lonacc.pm coordinates access to a wide range of administrative-type +functions (e.g. roles, logout, annotations, and bookmarks) as well +as coordinating access to educational resources. + + + + + +access handler for file transfers + + + + + +This module provides access to an educational resource construction area. +This module is invoked by the URL-related pattern syntax +LocationMatch "^/priv.*" or LocationMatch "^/\~.*". +Authentication of user identity +is coordinated through cookies. The abbreviation "cacc" corresponds +to "construction-space access"). If the cookie handle is invalid, then +this module returns a forbidden status and makes appropriate log entries. +If the cookie handle is valid, status is determined to be okay (and, +for the "priv"-type access, the resource is delivered by the +lonconstruct module). + + + + + +authenticate, set up session environment + + + + + +login screen + + + + + +logout + + + + + +replication + + + + + +This perl handling module reads in the available roles available +for a LON-CAPA user (different courses, different privileges, etc) +and produces a form-element HTML page which allows the user to select +which role he wishes to exercise in the LON-CAPA system. For instance, +a user may want to select between being a student in a thermodynamics +physics course or a teaching assistant for an introductory calculus +class. + + + + + +cross server filesystem browser + + + + + +Implements a second phase of importing multiple resources into the RAT. +Allows for reordering the sequence of resources. + + + + + +This file is an interface to the lonc processes of the LON-CAPA network +as well as set of elaborated functions for handling information necessary +for navigating through a given cluster of LON-CAPA machines within a domain. +There are over 40 specialized functions in this module which handle +the reading and transmission of metadata, user information +(ids, names, environments, roles, logs), file information (storage, reading, +directories, extensions, replication, embedded styles and descriptors), +educational resources (course descriptions, section names and numbers), +url hashing (to assign roles on a url basis), and translating abbreviated +symbols to and from more descriptive phrases or explanations. + + + + + +bumps to login + + + + + +symbolic link to /etc/mime.types + + + + + +symbolic link to /home/httpd/html/res + + + + + +static html page that is shown when an attempt is made to access a document not present on the web server + + + + + +static html page that is shown when an attempt is made to access a document which is restricted based on +file or server configurations + + + + + +frameset + + + + + +Parameter input window. + + + + + +javascript + + + + + +bumper + + + + + +A blank page with very minimal HTML structural elements. + + + + + +graphic files + + 1.1.dt.gif 1.1.empty.gif 1.1.ld.gif @@ -781,7 +1188,11 @@ inscol.gif inscond.gif insres.gif insrow.gif +left.gif +middle.gif resource.gif +rbottom.gif +right.gif sctd.gif sdt.gif sempty.gif @@ -800,85 +1211,193 @@ start.gif std.gif stdl.gif sutd.gif - - - - - directory DIRECTORY -- /home/httpd/html/adm/lonIcons -   - - - graphic file - *.gif - graphic files - logos - -listing
- + + + + + +icons to indicate an unexpected result + + +lonconstruct.gif +lonlogo_broken.gif +lonlogo_broken_tsp.gif + + + + + +icon to indicate an unexpected result + + + + + +icon to indicate an unexpected result + + + + + +icon to indicate an unexpected result + + + + + +logos + + +cab.gif +cab_big.gif +class.gif +class_big.gif +dvi.gif +dvi_big.gif +eps.gif +eps_big.gif +exam.gif +exam_big.gif +folder_closed.gif +folder_opened.gif +folder_pointer_closed.gif +folder_pointer_opened.gif +form.gif +form_big.gif +gif.gif +gif_big.gif +htm.gif +html.gif +html_big.gif +jpg.gif +jpg_big.gif liteani.gif -logo.gif -logos.gif - - - - empty directory EMPTY DIRECTORY -- /home/httpd/lonUsers - home dirs of local users - - - emptydirectory EMPTY DIRECTORY -- /home/httpd/html/lon-status - status reports - - - directory DIRECTORY -- /usr/lib/perl5/site_perl/5.005 -   - - - system file - tth.pm - system file - perl module for invoking functions specific to Tex-to-HTML conversion -   - - - system file - tth.so - system file - shared library file for dynamic loading and unloading -   - - - system file - capa.pm - system file - perl module for invoking functions specific to CAPA -   - - - system file - capa.bs - system file - bootstrap file associated with dynamic loading of this module on multiple architectures -   - - - system file - capa.so - system file - shared library file for dynamic loading and unloading -   - - - directory DIRECTORY -- /home/httpd/html/adm/MathML -   - - - system file - *.ent - static conf - entity files - -listing
- +lonlogo.gif +lonlogos.gif +meta.gif +meta_big.gif +mov.gif +mov_big.gif +move_down.gif +move_up.gif +page.gif +page_big.gif +pdf.gif +pdf_big.gif +problem.gif +problem_big.gif +ps.gif +ps_big.gif +quill.gif +quiz.gif +quiz_big.gif +select.gif +sequence.gif +sequence_big.gif +server.gif +server_big.gif +survey.gif +survey_big.gif +tex.gif +tex_big.gif +txt.gif +txt_big.gif +user.gif +user_big.gif +wav.gif +wav_big.gif +white_space_20_22.gif +whitespace1.gif +whitespace10.gif +whitespace2.gif +whitespace3.gif +whitespace4.gif +whitespace5.gif +whitespace6.gif +whitespace7.gif +whitespace8.gif +whitespace9.gif +xml.gif +xml_big.gif +zip.gif +zip_big.gif + + + + + +miscellaneous resources + + +cat_button.gif + + + + + +perl module for invoking functions specific to Tex-to-HTML conversion + + +Has the same dependencies and build process as tth.so. +Currently, only the tth.so file specifications invoke +the build process however. + + + + + +shared library file for dynamic loading and unloading + + +modules/TexConvert/tthperl/commands + + +../tthdynamic/tthfunc.c +../ttmdynamic/ttmfunc.c + + + + + +perl module for invoking functions specific to CAPA + + +Has the same dependencies and build process as capa.so. +Currently, only the capa.so file specifications invoke +the build process however. + + + + + +bootstrap file associated with dynamic loading of this module on multiple architectures + + +Has the same dependencies and build process as capa.so. +Currently, only the capa.so file specifications invoke +the build process however. + + + + + +shared library file for dynamic loading and unloading + + +loncom/homework/caparesponse/commands + + +caparesponse.c +caparesponse.pm +[ALWAYS_RUN_BUILD_COMMAND] + + + + + +entity files + + isoamsa.ent isoamsb.ent isoamsc.ent @@ -901,67 +1420,78 @@ isomscr.ent isonum.ent isopub.ent isotech.ent -mathml.dtd mmlalias.ent mmlextra.ent - - - - - system file - mathml.css - static conf - cascading style sheet -   - - - system file - mathml.dtd - static conf - document type definition -   - - - directory DIRECTORY -- /home/httpd/html/res/adm/includes -   - - - interface file - londes.js - interface file - Encryption Routines according to Data Encryption Standard DES, written in javascript -   - - - handler - default_homework.lcpm - handler - used by lonxml::xmlparse() as input variable $safeinit to Apache::run::run() -   - - - directory DIRECTORY -- /home/httpd/html/res/adm/pages -   - - - graphic file - *.gif - graphic files - icons used for the entire LON-CAPA user interface - -listing
- + + + + + +cascading style sheet + + + + + +document type definition + + + + + +Encryption Routines according to Data Encryption Standard DES, written in javascript + + + + + +used by lonxml::xmlparse() as input variable $safeinit to Apache::run::run() + + + + + +used by lonxml::xmlparse() as input variable $safeinit to Apache::run::run() + + + + + +Define unit prefixing and conversion for CAPA problem handling. + + + + + +icons used for the entire LON-CAPA user interface + + a.gif +anot.gif b.gif +back.gif +bkm.gif +brws.gif c.gif +ccrs.gif chat.gif +chrt.gif +com.gif +courses.gif +cprv.gif +cstr.gif d.gif +dempty.gif e.gif -endmenu.gif +empty.gif +enrl.gif +eval.gif f.gif +fdbk.gif feedback.gif -fnkmenu.gif +forw.gif g.gif +grds.gif group.gif h.gif help.gif @@ -972,69 +1502,100 @@ j.gif k.gif l.gif ledblink.gif +ledgreen.gif ledoff.gif ledon.gif ledsend.gif +logout.gif m.gif +mrk.gif n.gif -navmenu.gif +nav.gif next.gif o.gif p.gif +parm.gif +pgrd.gif +pparm.gif prev.gif +prt.gif q.gif +qempty.gif r.gif reload.gif remotebg.gif +res.gif +roles.gif s.gif +sbkm.gif space.gif spacer.gif +sprs.gif +src.gif +stat.gif +subm.gif t.gif title.gif u.gif v.gif +vbkm.gif w.gif x.gif y.gif z.gif - - - - interface file - imgmaps.html - interface file - image maps for the LON-CAPA remote control -   - - - interface file - index.html - interface file - welcoming page to the LON-CAPA system upon login -   - - - interface file - menu.html - interface file - renders the HTML (including image maps) for the LON-CAPA remote control -   - - - directory DIRECTORY -- /home/httpd/html/res/adm/pages/bookmarkmenu -   - - - graphic file - *.gif - graphic files - icons used for the bookmark portion of the LON-CAPA user interface - -listing
- -button_close.gif -button_edit.gif -button_preview.gif + + + + + +image maps for the LON-CAPA remote control + + + + + +welcoming page to the LON-CAPA system upon login + + + + + +renders the HTML (including image maps) for the LON-CAPA remote control + + + + + +icons used for the bookmark portion of the LON-CAPA user interface + + +a.gif +alert.black.gif +alert.red.gif +back.gif +ball.gray.gif +ball.red.gif +binary.gif +binhex.gif +blank.gif +bomb.gif +box1.gif +box2.gif +broken.gif +burst.gif +c.gif +comp.blue.gif +comp.gray.gif +compressed.gif +continued.gif +course.gif +dir.gif +down.gif +dvi.gif +f.gif +folder.gif +folder.open.gif +folder.sec.gif folder_closed.gif folder_closed_pressed.gif folder_new.gif @@ -1044,1241 +1605,175 @@ folder_pointer_closed.gif folder_pointer_opened.gif folder_spacer.gif folder_trash.gif -left_bar.gif -line_l_shape.gif -line_side_T.gif -line_vertical.gif +forward.gif +generic.gif +generic.red.gif +generic.sec.gif +hand.right.gif +hand.up.gif +html.gif +image1.gif +image2.gif +image3.gif +index.gif +layout.gif +left.gif link.gif -link_pressed.gif -ll_corner.gif -lower_bar.gif -lr_corner.gif -right_bar.gif -toolbar_bg.gif -ul_corner.gif -upper_bar.gif -ur_corner.gif - - - - interface file - *.html - interface file - associated with the frameset scheme of displaying bookmarks - -aaloader.html -annotator_bb.html -annotator_left.html -annotator_ll.html -annotator_lr.html -annotator_right.html -annotator_toolbar.html -annotator_ul.html -annotator_ur.html -annotator_uu.html -bookmarkpal.html -bookmarkpal_old.html -bookmarkpal_v2.html -bookmarkpal_v2_backup.html -index.html -loading_bookmarks.html - - - - interface file - bookmarklib.js - interface file - javascript for handling client-side interactions with bookmark interface -   - - - empty directory EMPTY DIRECTORY -- /home/httpd/html/res/adm/pages/annotations -   - - - directory DIRECTORY -- /usr/sbin -   - - - script file - loncapaverifypackages - script - checks the system RPMs against what install.lon-capa.org specifies -   - - - script file - loncapaverifybasepackage - script - checks the important base LON-CAPA files against what install.lon-capa.org specifies -   - - - script file - loncaparestoreconfigurations - script - restores .rpmsave files after a LON-CAPA-base upgrade -   - - - script file - loncapaautoupgrade - script - does all the things to coordinate updating of LON-CAPA base files. Should be used with caution so that you do not lose work. -   - - - script file - loncapaverify - script - makes verification report using loncapaverifypackages and loncapaverifybasepackage -   - - - directory DIRECTORY -- /etc/cron.d -   - - - static - loncapa - static conf - file that specifies periodic processes to run for the LON-CAPA machine -   - - - directory DIRECTORY -- /etc/ntp -   - - - configurable - step-tickers - conf - file that stimulates running of ntpdate upon init.d/xntpd initiation - configure - - -
just one line with the ip address of the server
- - - - directory DIRECTORY -- /etc/rc.d/init.d -   - - - root script - loncontrol - root script - system init and control handling for the LON-CAPA network - -multiple targets
- -
-/etc/rc.d/rc0.d/K05loncontrol
-/etc/rc.d/rc1.d/K05loncontrol
-/etc/rc.d/rc2.d/K05loncontrol
-/etc/rc.d/rc3.d/S95loncontrol
-/etc/rc.d/rc4.d/S95loncontrol
-/etc/rc.d/rc5.d/S95loncontrol
-/etc/rc.d/rc6.d/K05loncontrol
-
-
- - - directory DIRECTORY -- /etc/atalk -   - - - configurable - config - conf - configuration file to make LON-CAPA server file space accessible to Appleshares access (Macintosh) - configure
- - -Rolled in a RedHat 6.2 RPM, September 27, 2000 -

- -
-
-Name        : LON-CAPA-base                Relocations: (not relocateable)
-Version     : 3.1                               Vendor: Laboratory for Instructional Technology Education, 
-                                                        Division of Science and Mathematics Education, 
-							Michigan State University.
-Release     : 1                             Build Date: Wed Sep 27 13:56:46 2000
-Install date: (not installed)               Build Host: spock.lite.msu.edu
-Group       : Utilities/System              Source RPM: LON-CAPA-base-3.1-1.src.rpm
-Size        : 3650773                           License: GNU General Public License. Version 2, June 1991.
-                                                        Michigan State University patents may apply.
-Summary     : Basic system files for running a LON-CAPA server.
-Description :
-This package facilitates a base installation of LON-CAPA files in their directories.
-The files in this package are only those directly associated with the network communication
-layer established through direct server-to-server communications (via lond and lonc); plus
-those which configure (but otherwise not constitute) external software packages like Apache
-and Athena-Kerberos.  For more on the LON-CAPA project, visit http://www.lon-capa.org/.
-
-
- -

-Note: these files only refer to -

    -
  • those directly associated -with the network communication layer established through -direct server-to-server communications (via lond and lonc) -
  • those which configure (but otherwise not constitute) external software packages -like Apache and Athena-Kerberos. -
-and, these files -
    -
  • are all owned by user=www, group=users -
  • all represent their install-time configurations -(for instance, some directories start out as empty) -
  • are all ONLY under the read-write-execute privileges of user=www, -with different sets of permissions based on file type -
      -
    • chmod 400 -
      -r--------: static conf, handler, interface file, graphic files, system file -
    • chmod 600 -
      -rw-------: conf -
    • chmod 500 -
      -r-x------: script -
    -
  • unless otherwise specified, lists are separated by newlines (and subelements are separated with colons ':') -
-
-

2. File and Directory Table

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Files & DirectoriesTypeFunctionInstall
directory DIRECTORY -- /etc/httpd/conf 
configurableaccess.confconfdefine handlers, set parametersconfigure -
- - - - - - - -
lonHostIDLON-internal HostID of this machine
lonRoleRole of this machine: library, access
lonAdmEMailServer Administration
lonDefDomainDefault domain
lonLoadLimLoad Limit ( 100% loadavg )
lonExpireExpiration for local copies in seconds
-
configurablehttpd.confstatic confmain server configuration file 
configurablesrm.confstatic confname space configuration 
configurablestartup.plstatic confset paths to modules; invoked by access.conf 
directory DIRECTORY -- /home/httpd/lonTabsLON-CAPA Tables
staticfiletypes.tabstatic confDescriptive list of file extensions, and extension groupings 
staticroles.tabstatic confList of privileges associated with users of multiple types (for example: Teaching Assistant, Exam Proctor, Course Coordinator) 
staticrolesplain.tabstatic confDescriptive list of abbreviations used in roles.tab for user types and privileges available - in the network with function 
configurablehosts.tabconfList of all machines in the LON-CAPA network. Relates lonHostID to lonDefDomain and IP address 
configurablespare.tabconfSpare hosts to - offload session to if the LON-CAPA machine is overloaded -configure
- - - -
-list elements are separated by newlines -
-each list element consists of only one value; the value for lonHostID in access.conf -
-
statichtpasswdstatic confBasic auth - password to access /lon-status and /server-status 
directory DIRECTORY -- /etc 
configurablekrb.confconfwhich Kerberos server to contact for which Kerberos domainsconfigure
- - - -
-list elements are separated by newlines -
-each list element consists of only two subelements separated by a colon -
-
    -
  • Kerberos domain value -
  • Kerberos server IP address -
-
-
configurablesmb.confconfconfiguration file to make LON-CAPA server file space accessible to network neighborhoodconfigure
-
configurablentp.confconfwhich NTP server to contact for information (XNTP3 standard)configure
- - - -
-only one line needs to be changed to specify a server ip address -
-Example:
server ntp.msu.edu -
-
directory DIRECTORY -- /home/httpd/perlCommunication
scriptloncscriptproxy server 
scriptlondscriptremote command - interpreter 
scriptloncronscripthousekeeping 
scriptlonsqlscriptmaintain secondary database of metadata 
setuidlcpasswdsetuid scriptcoordinates the system services and files in order to allow lond to change user passwords 
setuidlcuseraddsetuid scriptcoordinates the system services and files in order to allow lond to add a new user 
setuidlcpasswdsetuid scriptcoordinates the system services and files in order to allow lond to add a new user 
setuidlcnfsonsetuid scriptcoordinates the system services and files in order to allow lond to enable NFS for a user 
setuidlcnfsoffsetuid scriptcoordinates the system services and files in order to allow lond to enable NFS for a user 
empty directory EMPTY DIRECTORY -- /home/httpd/perl/logslogs and pids of lonc, lond and lonnet.pm
empty directory EMPTY DIRECTORY -- /home/httpd/perl/tmplogs and pids of lonc, lond and lonnet.pm
directory DIRECTORY -- /home/httpd/lib/perl/Apachehandlers
handler.giflonmenu.pmhandlerHas routines which control the remote control. 
handler.giflonpageflip.pmhandlerDeals with forward, backward, and other page flips. 
handler.giflonratedt.pmhandlerBuilds up frame set and loads in the right thing. 
handler.gifadmannotations.pmhandlerThis will take annotations and then plug them into a page 
handler.gifadmbookmarks.pmhandlerThis will take bookmarks and get/write/display them for the LON-CAPA user interface 
handler.giflonratsrv.pmhandlerHandler tat takes output from RAT and stores it on disk. Handles the upper hidden frame of the added window that comes up in RAT. (3 frames come up in RAT server, code, and output. This module handles server connection.) 
handler.giflonpage.pmhandlerbundles pages into one page 
handler.giflonuserstate.pmhandlercompile course into binary data structure (in loncom/rat) 
handler.giflontex.pmhandlerHandler for tex files (somewhere in loncom/modules) 
handler.giflontexconvert.pmhandlerAccess to tth/ttm 
handler.giflonxml.pmhandlerXML Parsing Module 
handler.gifstyle.pmhandlerStyle Parsing Module 
handler.giflondefdef.pmhandlerTags Default Definition Module 
handler.gifrun.pmhandlerused to prevent poorly written problems from causing lingering after effects 
handler.gifscripttag.pmhandlerimplements <script>, <scriptlib>, <parserlib>, and <import> 
handler.giflonhomework.pmhandlerhandles requests for output, evaluation, and alteration of homework resource 
handler.gifinputtags.pmhandlerproduces HTML input tags (<INPUT>) for rendering homework resources 
handler.gifstructuretags.pmhandlerproduces HTML tags necessary for structuring the presentation of homework resourcese 
handler.gifresponse.pmhandlerdefines different types of responses given to student as well as syntax for producing response values 
handler.gifcaparesponse.pmhandlerhandles request to the CAPA homework processing engine 
handler.giflonacc.pmhandleraccess to for a LON-CAPA user session 
handler.giflonracc.pmhandleraccess handler for file transfers 
handler.gifloncacc.pmhandleraccess to construction area 
handler.giflonauth.pmhandlerauthenticate, set up session environment 
handler.giflonlogin.pmhandlerlogin screen 
handler.giflonlogout.pmhandlerlogout 
handler.giflonrep.pmhandlerreplication 
handler.giflonroles.pmhandlerroles picking 
handler.giflonindexer.pmhandlercross server - filesystem browser 
handler.giflonnet.pmhandlerinterface - to lonc 
empty directory EMPTY DIRECTORY -- /home/httpd/lonIDscookie jar
empty directoryEMPTY DIRECTORY -- /home/httpd/socketslonc's sockets
empty directoryEMPTY DIRECTORY -- /home/httpd/sockets/delayedlonc's sockets
directory DIRECTORY -- /home/httpd/html  
interface fileindex.htmlinterface filebumps to login 
linkrawsymbolic linksymbolic link to /home/httpd/html/res 
emptydirectory EMPTY DIRECTORY -- /home/httpd/html/resroot of resource tree
directory DIRECTORY -- /home/httpd/html/admunauthenticated resources
interface filenotfound.htmlinterface filestatic html page that is shown when an attempt is made to access a document not present on the web server 
interface fileunauthorized.htmlinterface filestatic html page that is shown when an attempt is made to access a document which is restricted based on -file or server configurations 
directory DIRECTORY -- /home/httpd/html/adm/rathome of the rat
interface filerat.htmlinterface fileframeset 
interface filecode.htmlinterface filejavascript 
interface filemap.htmlinterface filebumper 
graphic file*.gifgraphic filesimages for - ratlisting
- -1.1.dt.gif -1.1.empty.gif -1.1.ld.gif -1.1.lr.gif -1.1.rd.gif -1.1.rl.gif -1.1.td.gif -1.1.tdrl.gif -1.1.tl.gif -1.1.tr.gif -1.1.utd.gif -1.2.ctd.gif -1.2.dt.gif -1.2.empty.gif -1.2.ld.gif -1.2.lr.gif -1.2.lrd.gif -1.2.lrtd.gif -1.2.rd.gif -1.2.rl.gif -1.2.rld.gif -1.2.rltd.gif -1.2.rtd.gif -1.2.rtdl.gif -1.2.rtl.gif -1.2.td.gif -1.2.tdl.gif -1.2.tdrl.gif -1.2.tl.gif -1.2.tr.gif -1.2.utd.gif -2.1.dt.gif -2.1.empty.gif -2.1.ld.gif -2.1.lr.gif -2.1.rd.gif -2.1.rl.gif -2.1.td.gif -2.1.tdrl.gif -2.1.tl.gif -2.1.tr.gif -2.2.dt.gif -2.2.empty.gif -2.2.ld.gif -2.2.lr.gif -2.2.lrd.gif -2.2.lrt.gif -2.2.rd.gif -2.2.rl.gif -2.2.rld.gif -2.2.rlt.gif -2.2.td.gif -2.2.tdl.gif -2.2.tdr.gif -2.2.tdrl.gif -2.2.tl.gif -2.2.tr.gif -2.2.url.gif -2.2.utd.gif -arrow.gif -bdt.gif -bempty.gif -bld.gif -blr.gif -blrd.gif -blrt.gif -brd.gif -brl.gif -brld.gif -brlt.gif -btd.gif -btdl.gif -btdr.gif -btdrl.gif -btl.gif -btr.gif -burl.gif -butd.gif -condition.gif -edit.gif -finish.gif -info.gif -inscol.gif -inscond.gif -insres.gif -insrow.gif -resource.gif -sctd.gif -sdt.gif -sempty.gif -sld.gif -slr.gif -slrd.gif -slrtd.gif -srd.gif -srl.gif -srld.gif -srltd.gif -srtd.gif -srtdl.gif -srtl.gif -start.gif -std.gif -stdl.gif -sutd.gif - -
directory DIRECTORY -- /home/httpd/html/adm/lonIcons 
graphic file*.gifgraphic fileslogos -listing
- -liteani.gif -logo.gif -logos.gif -
empty directory EMPTY DIRECTORY -- /home/httpd/lonUsershome dirs of local users
emptydirectory EMPTY DIRECTORY -- /home/httpd/html/lon-statusstatus reports
directory DIRECTORY -- /usr/lib/perl5/site_perl/5.005 
system filetth.pmsystem fileperl module for invoking functions specific to Tex-to-HTML conversion 
system filetth.sosystem fileshared library file for dynamic loading and unloading 
system filecapa.pmsystem fileperl module for invoking functions specific to CAPA 
system filecapa.bssystem filebootstrap file associated with dynamic loading of this module on multiple architectures 
system filecapa.sosystem fileshared library file for dynamic loading and unloading 
directory DIRECTORY -- /home/httpd/html/adm/MathML 
system file*.entstatic confentity files -listing
- -isoamsa.ent -isoamsb.ent -isoamsc.ent -isoamsn.ent -isoamso.ent -isoamsr.ent -isobox.ent -isocyr1.ent -isocyr2.ent -isodia.ent -isogrk1.ent -isogrk2.ent -isogrk3.ent -isogrk4.ent -isolat1.ent -isolat2.ent -isomfrk.ent -isomopf.ent -isomscr.ent -isonum.ent -isopub.ent -isotech.ent -mathml.dtd -mmlalias.ent -mmlextra.ent - -
system filemathml.cssstatic confcascading style sheet 
system filemathml.dtdstatic confdocument type definition 
directory DIRECTORY -- /home/httpd/html/res/adm/includes 
interface filelondes.jsinterface fileEncryption Routines according to Data Encryption Standard DES, written in javascript 
handlerdefault_homework.lcpmhandlerused by lonxml::xmlparse() as input variable $safeinit to Apache::run::run() 
directory DIRECTORY -- /home/httpd/html/res/adm/pages 
graphic file*.gifgraphic filesicons used for the entire LON-CAPA user interface -listing
- -a.gif -b.gif -c.gif -chat.gif -d.gif -e.gif -endmenu.gif -f.gif -feedback.gif -fnkmenu.gif -g.gif -group.gif -h.gif -help.gif -hyphen.gif -i.gif -info.gif -j.gif -k.gif -l.gif -ledblink.gif -ledoff.gif -ledon.gif -ledsend.gif -m.gif -n.gif -navmenu.gif -next.gif -o.gif +mov.gif +movie1.gif p.gif -prev.gif -q.gif -r.gif -reload.gif -remotebg.gif -s.gif -space.gif -spacer.gif -t.gif -title.gif -u.gif -v.gif -w.gif -x.gif -y.gif -z.gif -
interface fileimgmaps.htmlinterface fileimage maps for the LON-CAPA remote control 
interface fileindex.htmlinterface filewelcoming page to the LON-CAPA system upon login 
interface filemenu.htmlinterface filerenders the HTML (including image maps) for the LON-CAPA remote control 
directory DIRECTORY -- /home/httpd/html/res/adm/pages/bookmarkmenu 
graphic file*.gifgraphic filesicons used for the bookmark portion of the LON-CAPA user interface -listing
- -button_close.gif -button_edit.gif -button_preview.gif -folder_closed.gif -folder_closed_pressed.gif +patch.gif +pdf.gif +portal.gif +problem.gif +ps.gif +quill.gif +right.gif +screw1.gif +screw2.gif +script.gif +sound1.gif +sound2.gif +sphere1.gif +sphere2.gif +tar.gif +tex.gif +text.gif +transfer.gif +unknown.gif +up.gif +uu.gif +uuencoded.gif +white_space_20_22.gif +white_space_22_22.gif +whitespace1.gif +whitespace10.gif +whitespace2.gif +whitespace3.gif +whitespace4.gif +whitespace5.gif +whitespace6.gif +whitespace7.gif +whitespace8.gif +whitespace9.gif +world1.gif +world2.gif + + + + + +icons used for directory indexing and login screen + + +folder_anim.gif +folder_close.gif +folder_drag.gif folder_new.gif -folder_opened.gif -folder_opened_pressed.gif +folder_open.gif folder_pointer_closed.gif folder_pointer_opened.gif -folder_spacer.gif +folder_static.gif folder_trash.gif +folder_trash_hover.gif left_bar.gif -line_l_shape.gif -line_side_T.gif -line_vertical.gif link.gif -link_pressed.gif +link_anim.gif +link_drag.gif ll_corner.gif lower_bar.gif lr_corner.gif +pix.gif right_bar.gif toolbar_bg.gif ul_corner.gif upper_bar.gif ur_corner.gif -
interface file*.htmlinterface fileassociated with the frameset scheme of displaying bookmarks -aaloader.html -annotator_bb.html -annotator_left.html -annotator_ll.html -annotator_lr.html -annotator_right.html -annotator_toolbar.html -annotator_ul.html -annotator_ur.html -annotator_uu.html -bookmarkpal.html -bookmarkpal_old.html -bookmarkpal_v2.html -bookmarkpal_v2_backup.html -index.html -loading_bookmarks.html -
interface filebookmarklib.jsinterface filejavascript for handling client-side interactions with bookmark interface 
empty directory EMPTY DIRECTORY -- /home/httpd/html/res/adm/pages/annotations 
directory DIRECTORY -- /usr/sbin 
script fileloncapaverifypackagesscriptchecks the system RPMs against what install.lon-capa.org specifies 
script fileloncapaverifybasepackagescriptchecks the important base LON-CAPA files against what install.lon-capa.org specifies 
script fileloncaparestoreconfigurationsscriptrestores .rpmsave files after a LON-CAPA-base upgrade 
script fileloncapaautoupgradescriptdoes all the things to coordinate updating of LON-CAPA base files. Should be used with caution so that you do not lose work. 
script fileloncapaverifyscriptmakes verification report using loncapaverifypackages and loncapaverifybasepackage 
directory DIRECTORY -- /etc/cron.d 
staticloncapastatic conffile that specifies periodic processes to run for the LON-CAPA machine 
directory DIRECTORY -- /etc/ntp 
configurablestep-tickersconffile that stimulates running of ntpdate upon init.d/xntpd initiationconfigure + + + + + +associated with the frameset scheme of displaying bookmarks + + +bookmarkmenu_toolbar.html +blank.html +closechildren.html + + + + + +javascript for handling client-side interactions with bookmark interface + + + + + +checks the system RPMs against what install.lon-capa.org specifies + + + + + +checks the important base LON-CAPA files against what install.lon-capa.org specifies + + + + + +restores .rpmsave files after a LON-CAPA-base upgrade + + + + + +does all the things to coordinate updating of LON-CAPA base files. Should be used with +caution so that you do not lose work + + + + + +makes verification report using loncapaverifypackages and loncapaverifybasepackage + + + + + +file that specifies periodic processes to run for the LON-CAPA machine + + + + + +file that stimulates running of ntpdate upon init.d/xntpd initiation + +
just one line with the ip address of the server
-
directory DIRECTORY -- /etc/rc.d/init.d 
root scriptloncontrolroot scriptsystem init and control handling for the LON-CAPA network -multiple targets
- -
-/etc/rc.d/rc0.d/K05loncontrol
-/etc/rc.d/rc1.d/K05loncontrol
-/etc/rc.d/rc2.d/K05loncontrol
-/etc/rc.d/rc3.d/S95loncontrol
-/etc/rc.d/rc4.d/S95loncontrol
-/etc/rc.d/rc5.d/S95loncontrol
-/etc/rc.d/rc6.d/K05loncontrol
-
-
directory DIRECTORY -- /etc/atalk 
configurableconfigconfconfiguration file to make LON-CAPA server file space accessible to Appleshares access (Macintosh)configure
-
+ + + + + + + + + + + + +system init and control handling for the LON-CAPA network + + + + + +configuration file to make LON-CAPA server file space accessible to Appleshares access (Macintosh) + +