--- doc/loncapafiles/Attic/loncapafiles.html 2000/09/24 01:08:06 1.2 +++ doc/loncapafiles/Attic/loncapafiles.html 2000/11/10 17:45:47 1.25 @@ -1,14 +1,1225 @@ - - Untitled Document + + LON-CAPA Files and Directories

LON-CAPA Files and Directories


Scott Harrison, September 2000 +
Scott Harrison, October 2000 +
Scott Harrison, November 2000
Gerd Kortemeyer, Spring-Summer 2000

+

    +
  1. Contents and Structure of loncapafiles.html +
  2. Software Package Information +
+

+
+

1. Contents and Structure of this loncapafiles.html

+

+This file contains specialized markup tags which encode information readable +by the LON-CAPA make/build process. This is meant to be "the master file" which +encodes all necessary configuration information to the associated make process. +The format of these tags is: +
<LONCAPA TYPE=type [otherparameters]> +

+

+Here are examples of all the different types of LONCAPA make/build tags. +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/modules/TexConvert/tthperl/lontex.pm" TARGET="home/httpd/lib/perl/Apache/lontex.pm" CATEGORY="handler"> +
<LONCAPA TYPE=DIRECTORY DIST="redhat6.2" TARGET="home/httpd/lib/perl/Apache" CATEGORY="writeable by server"> +
<LONCAPA TYPE=OWNERSHIP DIST="redhat6.2" CATEGORY="setuid" CHMOD="6755" CHOWN="root:root"> +
<LONCAPA TYPE=RPM NAME="Vendor" VALUE="Laboratory for Instructional Technology Education, Division of Science and Mathematics Education, Michigan State University."> +

+

+The NAME tags associated with TYPE=RPM are: +

+

+

+Data can also be attached to any LON-CAPA tag. This is especially important for files. This is shown by these three examples: +
<METAGROUP> +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/modules/TexConvert/tthperl/lontex.pm" TARGET="home/httpd/lib/perl/Apache/lontex.pm" CATEGORY="handler"> +
<DESCRIPTION> +
Handler for TeX files +
</DESCRIPTION> +
</METAGROUP> +
  +
<METAGROUP> +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/modules/TexConvert/tthperl/tth.so" TARGET="usr/lib/perl5/site_perl/5.005/tth.so" CATEGORY="system file"> +
<DESCRIPTION> +
shared library file for dynamic loading and unloading of TeX-to-HTML functionality +
</DESCRIPTION> +
<BUILD> +
loncom/modules/TexConvert/tthperl/commands +
</BUILD> +
<DEPENDENCIES> +
../tthdynamic/tthfunc.c +
../ttmdynamic/ttmfunc.c +
</DEPENDENCIES> +
</METAGROUP> +
  +
<METAGROUP> +
<LONCAPA TYPE=LOCATION DIST="redhat6.2" SOURCE="loncom/access.conf" TARGET="etc/httpd/conf/access.conf" CATEGORY="conf"> +
<DESCRIPTION> +
define handlers, set parameters +
</DESCRIPTION> +
<NOTE> +
<TABLE CELLPADDING=0 CELLSPACING=0 BORDER=1> +
<TR><TD><TT>lonHostID</TT></TD><TD>LON-internal HostID of this machine</TD></TR> +
<TR><TD><TT>lonRole</TT></TD><TD>Role of this machine: library, access</TD></TR> +
<TR><TD><TT>lonAdmEMail</TT></TD><TD>Server Administration</TD></TR> +
<TR><TD><TT>lonDefDomain</TT></TD><TD>Default domain</TD></TR> +
<TR><TD><TT>lonLoadLim</TT></TD><TD>Load Limit ( 100% loadavg )</TD></TR> +
<TR><TD><TT>lonExpire</TT></TD><TD>Expiration for local copies in seconds</TD></TR> +
</TABLE> +
</NOTE> +
</METAGROUP> +

+

+The METAGROUP tags for files are anticipatively limited to: NOTE, BUILD, DEPENDENCIES and DESCRIPTION. +

+

+To allow for viewing the tag information in a tabular HTML format, the make process generates +doc/loncapafiles/latestinstallconfiguration.html which +has the latest HTML presentation of the current LONCAPA tag configuration settings. Alternatively, +you can just view the internal tags of this HTML file. +

+
+

2. Software Package Information

+

+This section contains the actual LONCAPA tag information. These tags are probably not viewable with your +browser and can only be seen be examining the HTML source. +

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +define handlers, set parameters + + +configure +
+ + + + + + + +
lonHostIDLON-internal HostID of this machine
lonRoleRole of this machine: library, access
lonAdmEMailServer Administration
lonDefDomainDefault domain
lonLoadLimLoad Limit ( 100% loadavg )
lonExpireExpiration for local copies in seconds
+
+
+ + + +main server configuration file + + + + + +name space configuration + + + + + +set paths to modules; invoked by access.conf + + + + + +Descriptive list of file extensions, and extension groupings + + + + + directory DIRECTORY -- /home/httpd/lonTabs + static + roles.tab + static conf + List of privileges associated with users of multiple types (for example: Teaching Assistant, Exam Proctor, Course Coordinator) +   + + + static + rolesplain.tab + static conf + Descriptive list of abbreviations used in roles.tab for user types and privileges available + in the network with function +   + + + configurable + hosts.tab + conf + List of all machines in the LON-CAPA network. Relates lonHostID to lonDefDomain and IP address +   + + + configurable + spare.tab + conf + Spare hosts to + offload session to if the LON-CAPA machine is overloaded + +configure
+ + + +
+list elements are separated by newlines +
+each list element consists of only one value; the value for lonHostID in access.conf +
+ + + + static + htpasswd + static conf + Basic auth + password to access /lon-status and /server-status +   + + + directory DIRECTORY -- /etc +   + + + configurable + krb.conf + conf + which Kerberos server to contact for which Kerberos domains + configure
+ + + +
+list elements are separated by newlines +
+each list element consists of only two subelements separated by a colon +
+
    +
  • Kerberos domain value +
  • Kerberos server IP address +
+
+ + + + configurable + smb.conf + conf + configuration file to make LON-CAPA server file space accessible to network neighborhood + configure
+ + + configurable + ntp.conf + conf + which NTP server to contact for information (XNTP3 standard) + configure
+ + + +
+only one line needs to be changed to specify a server ip address +
+Example:
server ntp.msu.edu +
+ + + + directory DIRECTORY -- /home/httpd/perl + Communication + + + script + lonc + script + proxy server +   + + + script + lond + script + remote command + interpreter +   + + + script + loncron + script + housekeeping +   + + + script + lonsql + script + maintain secondary database of metadata +   + + + setuid + lcpasswd + setuid script + coordinates the system services and files in order to allow lond to change user passwords +   + + + setuid + lcuseradd + setuid script + coordinates the system services and files in order to allow lond to add a new user +   + + + setuid + lcpasswd + setuid script + coordinates the system services and files in order to allow lond to add a new user +   + + + setuid + lcnfson + setuid script + coordinates the system services and files in order to allow lond to enable NFS for a user +   + + + setuid + lcnfsoff + setuid script + coordinates the system services and files in order to allow lond to enable NFS for a user +   + + + empty directory EMPTY DIRECTORY -- /home/httpd/perl/logs + logs and pids of lonc, lond and lonnet.pm + + + empty directory EMPTY DIRECTORY -- /home/httpd/perl/tmp + logs and pids of lonc, lond and lonnet.pm + + + directory DIRECTORY -- /home/httpd/lib/perl/Apache + handlers + + + handler.gif + lonmenu.pm + handler + Has routines which control the remote control. +   + + + handler.gif + lonpageflip.pm + handler + Deals with forward, backward, and other page flips. +   + + + handler.gif + lonratedt.pm + handler + Builds up frame set and loads in the right thing. +   + + + handler.gif + admannotations.pm + handler + This will take annotations and then plug them into a page +   + + + handler.gif + admbookmarks.pm + handler + This will take bookmarks and get/write/display them for the LON-CAPA user interface +   + + + handler.gif + lonratsrv.pm + handler + Handler tat takes output from RAT and stores it on disk. Handles the upper hidden frame of the added window that comes up in RAT. (3 frames come up in RAT server, code, and output. This module handles server connection.) +   + + + handler.gif + lonpage.pm + handler + bundles pages into one page +   + + + handler.gif + lonuserstate.pm + handler + compile course into binary data structure (in loncom/rat) +   + + + handler.gif + lontex.pm + handler + Handler for tex files (somewhere in loncom/modules) +   + + + handler.gif + lontexconvert.pm + handler + Access to tth/ttm +   + + + handler.gif + lonxml.pm + handler + XML Parsing Module +   + + + handler.gif + style.pm + handler + Style Parsing Module +   + + + handler.gif + londefdef.pm + handler + Tags Default Definition Module +   + + + handler.gif + run.pm + handler + used to prevent poorly written problems from causing lingering after effects +   + + + handler.gif + scripttag.pm + handler + implements <script>, <scriptlib>, <parserlib>, and <import> +   + + + handler.gif + lonhomework.pm + handler + handles requests for output, evaluation, and alteration of homework resource +   + + + handler.gif + inputtags.pm + handler + produces HTML input tags (<INPUT>) for rendering homework resources +   + + + handler.gif + structuretags.pm + handler + produces HTML tags necessary for structuring the presentation of homework resourcese +   + + + handler.gif + response.pm + handler + defines different types of responses given to student as well as syntax for producing response values +   + + + handler.gif + caparesponse.pm + handler + handles request to the CAPA homework processing engine +   + + + handler.gif + lonacc.pm + handler + access to for a LON-CAPA user session +   + + + handler.gif + lonracc.pm + handler + access handler for file transfers +   + + + handler.gif + loncacc.pm + handler + access to construction area +   + + + handler.gif + lonauth.pm + handler + authenticate, set up session environment +   + + + handler.gif + lonlogin.pm + handler + login screen +   + + + handler.gif + lonlogout.pm + handler + logout +   + + + handler.gif + lonrep.pm + handler + replication +   + + + handler.gif + lonroles.pm + handler + roles picking +   + + + handler.gif + lonindexer.pm + handler + cross server + filesystem browser +   + + + handler.gif + lonnet.pm + handler + interface + to lonc +   + + + empty directory EMPTY DIRECTORY -- /home/httpd/lonIDs + cookie jar + + + empty directoryEMPTY DIRECTORY -- /home/httpd/sockets + lonc's sockets + + + empty directoryEMPTY DIRECTORY -- /home/httpd/sockets/delayed + lonc's sockets + + + directory DIRECTORY -- /home/httpd/html +    + + + interface file + index.html + interface file + bumps to login +   + + + link + raw + symbolic link + symbolic link to /home/httpd/html/res +   + + + emptydirectory EMPTY DIRECTORY -- /home/httpd/html/res + root of resource tree + + + directory DIRECTORY -- /home/httpd/html/adm + unauthenticated resources + + + interface file + notfound.html + interface file + static html page that is shown when an attempt is made to access a document not present on the web server +   + + + interface file + unauthorized.html + interface file + static html page that is shown when an attempt is made to access a document which is restricted based on +file or server configurations +   + + + directory DIRECTORY -- /home/httpd/html/adm/rat + home of the rat + + + interface file + rat.html + interface file + frameset +   + + + interface file + code.html + interface file + javascript +   + + + interface file + map.html + interface file + bumper +   + + + graphic file + *.gif + graphic files + images for + rat + listing
+ +1.1.dt.gif +1.1.empty.gif +1.1.ld.gif +1.1.lr.gif +1.1.rd.gif +1.1.rl.gif +1.1.td.gif +1.1.tdrl.gif +1.1.tl.gif +1.1.tr.gif +1.1.utd.gif +1.2.ctd.gif +1.2.dt.gif +1.2.empty.gif +1.2.ld.gif +1.2.lr.gif +1.2.lrd.gif +1.2.lrtd.gif +1.2.rd.gif +1.2.rl.gif +1.2.rld.gif +1.2.rltd.gif +1.2.rtd.gif +1.2.rtdl.gif +1.2.rtl.gif +1.2.td.gif +1.2.tdl.gif +1.2.tdrl.gif +1.2.tl.gif +1.2.tr.gif +1.2.utd.gif +2.1.dt.gif +2.1.empty.gif +2.1.ld.gif +2.1.lr.gif +2.1.rd.gif +2.1.rl.gif +2.1.td.gif +2.1.tdrl.gif +2.1.tl.gif +2.1.tr.gif +2.2.dt.gif +2.2.empty.gif +2.2.ld.gif +2.2.lr.gif +2.2.lrd.gif +2.2.lrt.gif +2.2.rd.gif +2.2.rl.gif +2.2.rld.gif +2.2.rlt.gif +2.2.td.gif +2.2.tdl.gif +2.2.tdr.gif +2.2.tdrl.gif +2.2.tl.gif +2.2.tr.gif +2.2.url.gif +2.2.utd.gif +arrow.gif +bdt.gif +bempty.gif +bld.gif +blr.gif +blrd.gif +blrt.gif +brd.gif +brl.gif +brld.gif +brlt.gif +btd.gif +btdl.gif +btdr.gif +btdrl.gif +btl.gif +btr.gif +burl.gif +butd.gif +condition.gif +edit.gif +finish.gif +info.gif +inscol.gif +inscond.gif +insres.gif +insrow.gif +resource.gif +sctd.gif +sdt.gif +sempty.gif +sld.gif +slr.gif +slrd.gif +slrtd.gif +srd.gif +srl.gif +srld.gif +srltd.gif +srtd.gif +srtdl.gif +srtl.gif +start.gif +std.gif +stdl.gif +sutd.gif + + + + + directory DIRECTORY -- /home/httpd/html/adm/lonIcons +   + + + graphic file + *.gif + graphic files + logos + +listing
+ +liteani.gif +logo.gif +logos.gif + + + + empty directory EMPTY DIRECTORY -- /home/httpd/lonUsers + home dirs of local users + + + emptydirectory EMPTY DIRECTORY -- /home/httpd/html/lon-status + status reports + + + directory DIRECTORY -- /usr/lib/perl5/site_perl/5.005 +   + + + system file + tth.pm + system file + perl module for invoking functions specific to Tex-to-HTML conversion +   + + + system file + tth.so + system file + shared library file for dynamic loading and unloading +   + + + system file + capa.pm + system file + perl module for invoking functions specific to CAPA +   + + + system file + capa.bs + system file + bootstrap file associated with dynamic loading of this module on multiple architectures +   + + + system file + capa.so + system file + shared library file for dynamic loading and unloading +   + + + directory DIRECTORY -- /home/httpd/html/adm/MathML +   + + + system file + *.ent + static conf + entity files + +listing
+ +isoamsa.ent +isoamsb.ent +isoamsc.ent +isoamsn.ent +isoamso.ent +isoamsr.ent +isobox.ent +isocyr1.ent +isocyr2.ent +isodia.ent +isogrk1.ent +isogrk2.ent +isogrk3.ent +isogrk4.ent +isolat1.ent +isolat2.ent +isomfrk.ent +isomopf.ent +isomscr.ent +isonum.ent +isopub.ent +isotech.ent +mathml.dtd +mmlalias.ent +mmlextra.ent + + + + + system file + mathml.css + static conf + cascading style sheet +   + + + system file + mathml.dtd + static conf + document type definition +   + + + directory DIRECTORY -- /home/httpd/html/res/adm/includes +   + + + interface file + londes.js + interface file + Encryption Routines according to Data Encryption Standard DES, written in javascript +   + + + handler + default_homework.lcpm + handler + used by lonxml::xmlparse() as input variable $safeinit to Apache::run::run() +   + + + directory DIRECTORY -- /home/httpd/html/res/adm/pages +   + + + graphic file + *.gif + graphic files + icons used for the entire LON-CAPA user interface + +listing
+ +a.gif +b.gif +c.gif +chat.gif +d.gif +e.gif +endmenu.gif +f.gif +feedback.gif +fnkmenu.gif +g.gif +group.gif +h.gif +help.gif +hyphen.gif +i.gif +info.gif +j.gif +k.gif +l.gif +ledblink.gif +ledoff.gif +ledon.gif +ledsend.gif +m.gif +n.gif +navmenu.gif +next.gif +o.gif +p.gif +prev.gif +q.gif +r.gif +reload.gif +remotebg.gif +s.gif +space.gif +spacer.gif +t.gif +title.gif +u.gif +v.gif +w.gif +x.gif +y.gif +z.gif + + + + interface file + imgmaps.html + interface file + image maps for the LON-CAPA remote control +   + + + interface file + index.html + interface file + welcoming page to the LON-CAPA system upon login +   + + + interface file + menu.html + interface file + renders the HTML (including image maps) for the LON-CAPA remote control +   + + + directory DIRECTORY -- /home/httpd/html/res/adm/pages/bookmarkmenu +   + + + graphic file + *.gif + graphic files + icons used for the bookmark portion of the LON-CAPA user interface + +listing
+ +button_close.gif +button_edit.gif +button_preview.gif +folder_closed.gif +folder_closed_pressed.gif +folder_new.gif +folder_opened.gif +folder_opened_pressed.gif +folder_pointer_closed.gif +folder_pointer_opened.gif +folder_spacer.gif +folder_trash.gif +left_bar.gif +line_l_shape.gif +line_side_T.gif +line_vertical.gif +link.gif +link_pressed.gif +ll_corner.gif +lower_bar.gif +lr_corner.gif +right_bar.gif +toolbar_bg.gif +ul_corner.gif +upper_bar.gif +ur_corner.gif + + + + interface file + *.html + interface file + associated with the frameset scheme of displaying bookmarks + +aaloader.html +annotator_bb.html +annotator_left.html +annotator_ll.html +annotator_lr.html +annotator_right.html +annotator_toolbar.html +annotator_ul.html +annotator_ur.html +annotator_uu.html +bookmarkpal.html +bookmarkpal_old.html +bookmarkpal_v2.html +bookmarkpal_v2_backup.html +index.html +loading_bookmarks.html + + + + interface file + bookmarklib.js + interface file + javascript for handling client-side interactions with bookmark interface +   + + + empty directory EMPTY DIRECTORY -- /home/httpd/html/res/adm/pages/annotations +   + + + directory DIRECTORY -- /usr/sbin +   + + + script file + loncapaverifypackages + script + checks the system RPMs against what install.lon-capa.org specifies +   + + + script file + loncapaverifybasepackage + script + checks the important base LON-CAPA files against what install.lon-capa.org specifies +   + + + script file + loncaparestoreconfigurations + script + restores .rpmsave files after a LON-CAPA-base upgrade +   + + + script file + loncapaautoupgrade + script + does all the things to coordinate updating of LON-CAPA base files. Should be used with caution so that you do not lose work. +   + + + script file + loncapaverify + script + makes verification report using loncapaverifypackages and loncapaverifybasepackage +   + + + directory DIRECTORY -- /etc/cron.d +   + + + static + loncapa + static conf + file that specifies periodic processes to run for the LON-CAPA machine +   + + + directory DIRECTORY -- /etc/ntp +   + + + configurable + step-tickers + conf + file that stimulates running of ntpdate upon init.d/xntpd initiation + configure + + +
just one line with the ip address of the server
+ + + + directory DIRECTORY -- /etc/rc.d/init.d +   + + + root script + loncontrol + root script + system init and control handling for the LON-CAPA network + +multiple targets
+ +
+/etc/rc.d/rc0.d/K05loncontrol
+/etc/rc.d/rc1.d/K05loncontrol
+/etc/rc.d/rc2.d/K05loncontrol
+/etc/rc.d/rc3.d/S95loncontrol
+/etc/rc.d/rc4.d/S95loncontrol
+/etc/rc.d/rc5.d/S95loncontrol
+/etc/rc.d/rc6.d/K05loncontrol
+
+
+ + + directory DIRECTORY -- /etc/atalk +   + + + configurable + config + conf + configuration file to make LON-CAPA server file space accessible to Appleshares access (Macintosh) + configure
+ + +
Rolled in a RedHat 6.2 RPM, September 27, 2000 +

+ +
+
+Name        : LON-CAPA-base                Relocations: (not relocateable)
+Version     : 3.1                               Vendor: Laboratory for Instructional Technology Education, 
+                                                        Division of Science and Mathematics Education, 
+							Michigan State University.
+Release     : 1                             Build Date: Wed Sep 27 13:56:46 2000
+Install date: (not installed)               Build Host: spock.lite.msu.edu
+Group       : Utilities/System              Source RPM: LON-CAPA-base-3.1-1.src.rpm
+Size        : 3650773                           License: GNU General Public License. Version 2, June 1991.
+                                                        Michigan State University patents may apply.
+Summary     : Basic system files for running a LON-CAPA server.
+Description :
+This package facilitates a base installation of LON-CAPA files in their directories.
+The files in this package are only those directly associated with the network communication
+layer established through direct server-to-server communications (via lond and lonc); plus
+those which configure (but otherwise not constitute) external software packages like Apache
+and Athena-Kerberos.  For more on the LON-CAPA project, visit http://www.lon-capa.org/.
+
+
+ +

Note: these files only refer to

  • those directly associated @@ -22,10 +1233,20 @@ and, these files
  • are all owned by user=www, group=users
  • all represent their install-time configurations (for instance, some directories start out as empty) -
  • are all ONLY under the read-write (and sometimes execute) privileges of user=www (-rwx------) +
  • are all ONLY under the read-write-execute privileges of user=www, +with different sets of permissions based on file type +
      +
    • chmod 400 +
      -r--------: static conf, handler, interface file, graphic files, system file +
    • chmod 600 +
      -rw-------: conf +
    • chmod 500 +
      -r-x------: script +
  • unless otherwise specified, lists are separated by newlines (and subelements are separated with colons ':')
- +
+

2. File and Directory Table

@@ -101,9 +1322,9 @@ and, these files - + - + @@ -141,8 +1362,7 @@ each list element consists of only one v - + + + + + + + + + + + + + + @@ -192,6 +1435,41 @@ each list element consists of only two s + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + @@ -206,6 +1484,76 @@ each list element consists of only two s + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + @@ -229,14 +1577,14 @@ each list element consists of only two s - + - + @@ -311,16 +1659,16 @@ each list element consists of only two s - + - + - + - + @@ -571,6 +1919,20 @@ logos.gif + + + + + + + + + + + + + + @@ -649,12 +2011,19 @@ mmlextra.ent - + - + + + + + + + + @@ -736,6 +2105,180 @@ z.gif + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
Files & Directories 
staticconfigurable hosts.tabstatic confconf List of all machines in the LON-CAPA network. Relates lonHostID to lonDefDomain and IP address  
configurable krb.conf confwhich Kerberos - server to contact for which Kerberos domainswhich Kerberos server to contact for which Kerberos domains configure
@@ -159,6 +1379,29 @@ each list element consists of only two s
configurablesmb.confconfconfiguration file to make LON-CAPA server file space accessible to network neighborhoodconfigure
+
configurablentp.confconfwhich NTP server to contact for information (XNTP3 standard)configure
+ + + +
+only one line needs to be changed to specify a server ip address +
+Example:
server ntp.msu.edu +
+
directory DIRECTORY -- /home/httpd/perl Communicationmaintain secondary database of metadata  
setuidlcpasswdsetuid scriptcoordinates the system services and files in order to allow lond to change user passwords 
setuidlcuseraddsetuid scriptcoordinates the system services and files in order to allow lond to add a new user 
setuidlcpasswdsetuid scriptcoordinates the system services and files in order to allow lond to add a new user 
setuidlcnfsonsetuid scriptcoordinates the system services and files in order to allow lond to enable NFS for a user 
setuidlcnfsoffsetuid scriptcoordinates the system services and files in order to allow lond to enable NFS for a user 
empty directory EMPTY DIRECTORY -- /home/httpd/perl/logs logs and pids of lonc, lond and lonnet.pm
handler.giflonmenu.pmhandlerHas routines which control the remote control. 
handler.giflonpageflip.pmhandlerDeals with forward, backward, and other page flips. 
handler.giflonratedt.pmhandlerBuilds up frame set and loads in the right thing. 
handler.gifadmannotations.pmhandlerThis will take annotations and then plug them into a page 
handler.gifadmbookmarks.pmhandlerThis will take bookmarks and get/write/display them for the LON-CAPA user interface 
handler.giflonratsrv.pmhandlerHandler tat takes output from RAT and stores it on disk. Handles the upper hidden frame of the added window that comes up in RAT. (3 frames come up in RAT server, code, and output. This module handles server connection.) 
handler.giflonpage.pmhandlerbundles pages into one page 
handler.giflonuserstate.pmhandlercompile course into binary data structure (in loncom/rat) 
handler.giflontex.pmhandlerHandler for tex files (somewhere in loncom/modules) 
handler.giflontexconvert.pmhandlerAccess to tth/ttm 
handler.gif lonxml.pm handler XML Parsing Modulehandler.gif run.pm handlerevaluates expression within a memory-safe environment (to protect system from break-in attempts)used to prevent poorly written problems from causing lingering after effects  
handler.gif scripttag.pm handlerparse and evaluate contents of values within a <script> tag (this module invokes run.pm)implements <script>, <scriptlib>, <parserlib>, and <import>  
handler.giflonrep.pmlonlogout.pm handlerreplicationlogout  
handler.giflonproblem.pmlonrep.pm handlerassessmentsreplication  
system filetth.pmsystem fileperl module for invoking functions specific to Tex-to-HTML conversion 
system filetth.sosystem fileshared library file for dynamic loading and unloading 
system file capa.pm system file perl module for invoking functions specific to CAPA 
graphic fileinterface file londes.jsscriptinterface file Encryption Routines according to Data Encryption Standard DES, written in javascript  
handlerdefault_homework.lcpmhandlerused by lonxml::xmlparse() as input variable $safeinit to Apache::run::run() 
directory DIRECTORY -- /home/httpd/html/res/adm/pages  renders the HTML (including image maps) for the LON-CAPA remote control  
directory DIRECTORY -- /home/httpd/html/res/adm/pages/bookmarkmenu 
graphic file*.gifgraphic filesicons used for the bookmark portion of the LON-CAPA user interface +listing
+ +button_close.gif +button_edit.gif +button_preview.gif +folder_closed.gif +folder_closed_pressed.gif +folder_new.gif +folder_opened.gif +folder_opened_pressed.gif +folder_pointer_closed.gif +folder_pointer_opened.gif +folder_spacer.gif +folder_trash.gif +left_bar.gif +line_l_shape.gif +line_side_T.gif +line_vertical.gif +link.gif +link_pressed.gif +ll_corner.gif +lower_bar.gif +lr_corner.gif +right_bar.gif +toolbar_bg.gif +ul_corner.gif +upper_bar.gif +ur_corner.gif +
interface file*.htmlinterface fileassociated with the frameset scheme of displaying bookmarks +aaloader.html +annotator_bb.html +annotator_left.html +annotator_ll.html +annotator_lr.html +annotator_right.html +annotator_toolbar.html +annotator_ul.html +annotator_ur.html +annotator_uu.html +bookmarkpal.html +bookmarkpal_old.html +bookmarkpal_v2.html +bookmarkpal_v2_backup.html +index.html +loading_bookmarks.html +
interface filebookmarklib.jsinterface filejavascript for handling client-side interactions with bookmark interface 
empty directory EMPTY DIRECTORY -- /home/httpd/html/res/adm/pages/annotations 
directory DIRECTORY -- /usr/sbin 
script fileloncapaverifypackagesscriptchecks the system RPMs against what install.lon-capa.org specifies 
script fileloncapaverifybasepackagescriptchecks the important base LON-CAPA files against what install.lon-capa.org specifies 
script fileloncaparestoreconfigurationsscriptrestores .rpmsave files after a LON-CAPA-base upgrade 
script fileloncapaautoupgradescriptdoes all the things to coordinate updating of LON-CAPA base files. Should be used with caution so that you do not lose work. 
script fileloncapaverifyscriptmakes verification report using loncapaverifypackages and loncapaverifybasepackage 
directory DIRECTORY -- /etc/cron.d 
staticloncapastatic conffile that specifies periodic processes to run for the LON-CAPA machine 
directory DIRECTORY -- /etc/ntp 
configurablestep-tickersconffile that stimulates running of ntpdate upon init.d/xntpd initiationconfigure + + +
just one line with the ip address of the server
+
directory DIRECTORY -- /etc/rc.d/init.d 
root scriptloncontrolroot scriptsystem init and control handling for the LON-CAPA network +multiple targets
+ +
+/etc/rc.d/rc0.d/K05loncontrol
+/etc/rc.d/rc1.d/K05loncontrol
+/etc/rc.d/rc2.d/K05loncontrol
+/etc/rc.d/rc3.d/S95loncontrol
+/etc/rc.d/rc4.d/S95loncontrol
+/etc/rc.d/rc5.d/S95loncontrol
+/etc/rc.d/rc6.d/K05loncontrol
+
+
directory DIRECTORY -- /etc/atalk 
configurableconfigconfconfiguration file to make LON-CAPA server file space accessible to Appleshares access (Macintosh)configure
+